SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_025059157.1.3964 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_025059157.1.3964
Domain Number 1 Region: 456-568
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-17
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_025059157.1.3964
Sequence length 572
Comment sodium-independent anion transporter [Sulfitobacter donghicola]; AA=GCF_000622405.1; RF=representative genome; TAX=1300350; STAX=421000; NAME=Sulfitobacter donghicola DSW-25 = KCTC 12864 = JCM 14565; strain=KCTC 12864; AL=Contig; RT=Major
Sequence
MSMTLSNYLPVLTWGRQYDRSALSNDLMAALIVTIMLIPQSLAYALLAGLPPEAGLYASI
VPIILYSMFGTSRALAVGPVAVVSLMTAAALSNIVEQGTMGYAVAALSLAGLSGVMLLAM
GLFRLGFIANFLSHPVIAGFITASGIIIAASQLKHIFGVDAHGHNLLDLVLSLAAHLSDI
NWITAVIGVLATGFLFWVRKGLKPMLEGLGLGETLTGVLVKTGPVAVVVLTTFAVWVFGL
ADRGVKIVGEVPQSLPPFTIPSFSPDLLGQLLLPAFLISIIGFVESISVAQTLAAKKRQR
IDPDQELIGLGAANIGASLTGGFPVTGGFSRSVVNFDAGAETPAAGAFTAVGLAIAALAL
TPLIYFLPKATLAATIIVAVLSLVDFSILKRSWDYSKADFAAVLVTILLTLIVGVEIGVS
AGVGLSILLHLYKSSKPHVAEVGQVPGTEHYRNILRHVVITEPSVVTLRVDESLYFANAR
FLEDKVYNRVAGDKEIRHVILQCSAINEIDLSALESLEMINNRLHEMDVKLHLSEVKGPV
MDRLKEQHFLQEMTGEIFLTQYEAAKTVSEKT
Download sequence
Identical sequences A0A073IMF4
WP_025059157.1.3964 WP_025059157.1.50323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]