SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_026149180.1.30997 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_026149180.1.30997
Domain Number 1 Region: 658-1074
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.22e-30
Family alpha-mannosidase, C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 272-556
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000612
Family alpha-mannosidase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_026149180.1.30997
Sequence length 1097
Comment glycoside hydrolase [Elizabethkingia meningoseptica]; AA=GCF_001521755.1; RF=na; TAX=238; STAX=238; NAME=Elizabethkingia meningoseptica; strain=KC1913; AL=Scaffold; RT=Major
Sequence
MTNSLMYAQKKVPFFGSIQSINGYATEISGENIDYFSAFPDHATRALLTRATDGAKTIEW
ETAPAPQKITAPYVYFSWLVSHSSGSSGGIRNFDLYINNQKSLTLTTYPVNQKPNWIAKA
ADSTAFVFNQTKMDGLKDSYGIAYLRIPASKVTPGKPIRLKIVGQAQDSRDWFMTYKFTF
QEKMDAASTPFILKDGKRLITLTTLHFGPEQKITATIDNKENFSFTMPDGIKTFDIPVTL
SSKGGSVALTVTSGNKQLLHKTIQAGPVVPRTLYFIHHSHTDVGYSHLQSEVEKIHTKNI
YDALKMIEETRNLPEEARFKWNVEALWDVENFMQKATAEEKKSFVKAVKEGNIGLSAMYA
NILTGLSQPEELFHYTEYAQKLEKEYGLNITSAMMSDVPGFAWSLVPALTSSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWESPSGEEKILFWTAGRGYSSWHGIHPGAVFE
NGQKKIAEYLEDLTKTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDKIPVVKGDISPHWEDGAMSTAKEEGLNRNSSLKLQQLTTLYSMLNP
GQYNNQSFYEAWRNVILFHEHTWGAFNSITAPDLPFATDQWKVKKQFSLDGSTLANKLEA
DLLQPLTDPASNIIAVYNTSSWVRDGLVILPVQAQANAVQDFKGNKTPLQKLENGTMAFI
ARNIPPLSSATYTIIKDSSPKTSVFSITDHSISNGKINLTWDNKTGSITHFTDNNGTTNY
AGTFNNQGLNSYWYVPGTNPQDSQSNTNVQVNVLENGPVLAKISLTSEAPGAHRLEKIIT
LISGSDEVTLENIINKKPIRTKESVHFGFPFNKEFKNITADAGYGVMKYLTDQLPGSNMD
YWYSRRWVDASFGQKGMQWMLLEAPLIEAAEMIDERLQIDNSHKKWKDKGTPDTTNWFSY
AMNNYWHTNYKADQEGPVHYRYALRPHGTFNSVENEKYAAAFTQPLIAIPVNKKATVKGS
LFHMNNDKIVVTTITPQEDHSFIIRLYNPDEKEQSTTFIWEQLKPSKLIHLKTEKTISIN
DTISLNGMDVIEIKAIP
Download sequence
Identical sequences A0A1T3FAW8
WP_026149180.1.13427 WP_026149180.1.30997 WP_026149180.1.40770 WP_026149180.1.54035 WP_026149180.1.54849 WP_026149180.1.59614 WP_026149180.1.75841 WP_026149180.1.91748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]