SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_026256904.1.14137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_026256904.1.14137
Domain Number 1 Region: 567-655,709-1039
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.28e-20
Family alpha-mannosidase, C-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 127-320
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.84e-16
Family alpha-mannosidase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_026256904.1.14137
Sequence length 1083
Comment hypothetical protein [Actinopolymorpha alba]; AA=GCF_000373925.1; RF=representative genome; TAX=1120950; STAX=533267; NAME=Actinopolymorpha alba DSM 45243; strain=DSM 45243; AL=Scaffold; RT=Major
Sequence
MTTRLLTRSGHAPGRRTLREALSATSLIPFLRLGVGTSISGAALPLFRRRPDGGLDQVVR
LAFEQPLPDPERIEVRRPDGKLAVSWTGRIPAHGVLDLLVPEITAESAWRVAVTVAGVEY
AGELAVAPGRKLTVHLVHHSHLDIGYTDRQGVVLRHQEEYLDAAVELARQNADDGDPDTW
FRWTVESNLPVRSWLRHRPTSVVEEFSRLAREDIVEVTAMPFNLHTEMASQEELARLLRS
VFEFRERYGIPVTSAMHTDVPGATTGWVDALVDAGVRYLSAAHNWAGRSVPYLVGGQELS
RPFWWCTPGGSRLLTWFTDSAHGAAYLEGNLVGLSNSYDEVIDLLPLYLQALVSKPFPYY
DAVFGLSGIPDGADITRQPYAFDLLQLRVQGDHSDNAGPSATPARIAAQWNAEWAYPRLV
SATNTSFLAEVERTIGDRLAEHTGDWGDWWADGVGAGARPLGHNRRTQATLRTAETLHTL
ADLHSGSPMPVREVVDEIYDKVGLFDEHTWGAANPWHDRERGADSGALQWTRKSEYAYQA
YDEALDLLHSGIRRLGAGFGVPPFTDVAGSLAVYNTTGWARTDVVRSFLPESQFPLGIRR
LGVVDPRTDERVPVRINAERRPAAPRGWHVEFVARDVPPLGWARFDLVPVDEDPFSNEET
GAGSVGVGPSELVAASATAGAISGHGFGDSSLGVGPDGLPVMPAPKAAYRMANEFYELTY
DPAQAMVTSIVDRRTGRELVNPDALTGLNEYIYDTYGSASRVNRLSSRVEARDLTLLTSR
QLAGNAVVLNVEHSAVGDFLEVEVRAPGVDWIRTTISLYSGVPRVEITNRVSKRASTTKE
SGFFAFPLAGNSEPVYELTGSVAGAGISHVPGTPHHMHAIRHWVGVSEDGCATVWATLEA
PLVEFGTIALPYQPYPSTLVLERPEPATVYSWVFNNIWDTNFPSQQEGEMTFSYAVTSSA
DQAVESLGAMTAAALTEPLVGVLGNGRGVAPLVSSGSLLTLSRSEVVVSSVARPLDGSAG
VAIRLRSLASEPVEVEVVLEAFDAATAQVTTPWEREGVEVVVENGRVWFEIPAGASRTLL
LRR
Download sequence
Identical sequences WP_026256904.1.14137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]