SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_026401205.1.44231 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_026401205.1.44231
Domain Number 1 Region: 129-326
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.61e-19
Family 4-alpha-glucanotransferase, N-terminal domain 0.085
Further Details:      
 
Domain Number 2 Region: 572-1030
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.7e-19
Family alpha-mannosidase, C-terminal domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_026401205.1.44231
Sequence length 1035
Comment hypothetical protein [Actinomadura rifamycini]; AA=GCF_000425065.1; RF=representative genome; TAX=1120937; STAX=31962; NAME=Actinomadura rifamycini DSM 43936; strain=DSM 43936; AL=Scaffold; RT=Major
Sequence
MTSRLLQASLGSPDYDGIRDALRRDTSAEVLAVRGLSVRAAVLPLFRRDPADGPAGPLRQ
AVRLTLEAAGADGPAGGGLEVALVDGGEVLASAPADGPSVTLLVPEVDAPRRVTLEVRGG
GGLVGAAPLDITPQRKWNVFVVHHSHLDIGYTDTQGTVLRHHLDYLDAALRLARETDGRP
DDARFRWSVESSLPALRWLATRPDDQVAEFVERVRAGNIEITAFPMQLHLEACSTEELYR
QLRFVEDLRRDHGIEVRSAMHTDVPGAVVGTVDALNAAGVRYLAAAHNWAGRSVPYVTGG
DKLGRPFRWRSPGGGELLVWFTDTPHGMAYMEGNTVGLVDGYDLAEDLLPRYLSALADRP
YPYGPGTFGWYAAPGQVGAAKDPDVLDAVHLRVQGAHADNAGPSLVPADIAHRWNETWAY
PRLRSAANADFFAYVEEHHADRLQVHEGDWTDWWADGLGSGARPLGYVRRAQSALRAAET
LHAFADERSGDRTGAPAAIDAAYDGAALFDEHTWGAANPWEDAEEGGDSGGLQWTRKSQV
GYQAHDDALDLLQSGARRIGATFGPAPDALASFVVVNPGTAARTDVARAFLPRDVVPADV
PIALVDARTGEPVPHREEEVDPDEWPTRPIGRHLDAIVRDLPGHGHVRLDVVRAAEPAPA
PADLGTADATIENAHYRVAFDVREGHIASVFDKAAGRELVNAGAAAGFGQYVYDRYATAP
HFNHMSGHMLVHDKTMLGDRAIATHATVVRRERTPAGERLVVEARGKGVDWLRTTIDLWT
DVPRVDVRFQLGKQPTAAKEAVFFAFPFAVGGPPAAWELTGGVGGTHVPSVPGSAEHMRP
VRHWVAFEDPDLTVAWATLEAPLVQFGSIHMPYAPFPPTLDPEDGTVYSWALNNIWDTNF
PSQQQGETTFRYAFASAPAGSGRRLGARTAAGLTDPFVATLATGAEPAEAGAFLRVDDPD
VLVTSVGRARDGDGLAIRLQSLASGPVETGLHVPGYTRASLSAGLERDPADLPVRDGTTT
VRLPACGVATVTVRR
Download sequence
Identical sequences WP_026401205.1.44231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]