SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_027075061.1.20148 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_027075061.1.20148
Domain Number 1 Region: 6-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.75e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_027075061.1.20148
Sequence length 107
Comment MULTISPECIES: hypothetical protein [Mannheimia]; AA=GCF_000584935.1; RF=na; TAX=1450449; STAX=75985; NAME=Mannheimia haemolytica serotype A1/A6 str. PKL10; strain=PKL10; AL=Contig; RT=Major
Sequence
MPQKTLQWDIQQNNESLFVRLSGELTRNTLLPLWKQRASFLSPKANQHLYWDLKEITRVD
SAGFTLLAELLNHYHKIIPNSLINIPDSVKTLADLYDLDGWFEQFII
Download sequence
Identical sequences A0A011ND54
WP_027075061.1.20148 WP_027075061.1.3713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]