SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_027371923.1.9600 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_027371923.1.9600
Domain Number 1 Region: 666-935,975-1075
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.15e-30
Family alpha-mannosidase, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 272-568
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000889
Family 4-alpha-glucanotransferase, N-terminal domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_027371923.1.9600
Sequence length 1096
Comment glycoside hydrolase [Chryseobacterium sp. UNC8MFCol]; AA=GCF_000482305.1; RF=na; TAX=1340435; STAX=1340435; NAME=Chryseobacterium sp. UNC8MFCol; strain=UNC8MFCol; AL=Scaffold; RT=Major
Sequence
MTGNGMYAQEKAPYFGNIQAINGYEREISGENIDYFSAFPDHANRALLTRTTDGKKTIEW
ETASVPLKNNGQYVYFNWLVSHSSGTSGGARNFDLYINDQKTLTLTTYPANQHPDWISKA
ADSTAFIFHQTTTDGLKDSYGIAYLRVPANKVTPGKPLRLKIVGQAQNSRDWMMTYKFTF
QEKIDAQSTPFLLKDGKRLLSLTTLHFGPEEKIKAIINNKETFTFTMPDGIKTFDIPVSL
SAEGGKLELVVISGRKELLRKTIQAQAIVPRTLYFIHHSHTDVGYSHLQSEVEKIHTKNI
YDALAMIEKTKNLPEEARFKYNVEALWDVENFMKNASAQDKKSFVKAVQEGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKELGLPIKSAMMSDVPGFAWSLVPALTSSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGVHPGDVFD
NGQKKIAEYLEDLTHSNYPYDMVQWRYNIVADNGPIDPTVSQFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDKIPVVKGDISPYWEDGAMSTAKEEGINRNSSLKLQQLTTLYSMLNP
RQYNSRHFYEAWKNVILFHEHTWGAFNSITAPDLPFVADQWKVKKQFSADGSFLSEKLEK
ELLLPLTDPASKTIAVFNTSSWAREGIVTIPENTQANAVQDATGQKIPLQKLQDGTMTFL
AKNIPALGSATYTLIKNKISSPSSFIITDSSISNGKVTVSWDKKTGSITHLTDTTKTNYA
GSFNDQGLNSYWYVPRSDPKEALSNTDVQVKILENGPVVAKISLVSEAPGARKLERMITI
TAGSDEIALENIVDKKPVRTKEAVHFGFPFNPDFKNITVDAGYGNMKYLTDQLPGSNMDY
WYSRRWVDASSAQKGIQWMMLETPLIEAATMIDERMVIDNSHKKWKDNGTPGATNWFSYA
MNNYWHTNYKADQEGPVHYHYVLRPHDGFNSVENEKSAAAFTQPLIAVPVKEQSFSSGSL
FHMNNDKIVVTSITPQEDQSFIIRLYNPDEKGQVTAFQWEKLKPVKLINLKTGKEFSITE
KFSLEGMDVLEIKVIF
Download sequence
Identical sequences WP_027371923.1.9600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]