SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_028729586.1.74405 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_028729586.1.74405
Domain Number 1 Region: 536-963
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-30
Family alpha-mannosidase, C-terminal domain 0.007
Further Details:      
 
Domain Number 2 Region: 121-458
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000361
Family alpha-mannosidase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_028729586.1.74405
Sequence length 965
Comment glycosyl hydrolase [Parabacteroides gordonii]; AA=GCF_000428565.1; RF=na; TAX=1122931; STAX=574930; NAME=Parabacteroides gordonii DSM 23371; strain=DSM 23371; AL=Scaffold; RT=Major
Sequence
MKKRIAYCLFASVLSSMIYADVVPSTIDYVVRPLYGYRADGTPGRIVTVKLKGKELKGDL
SVDVITKGKTEKNHFVLNAKDSTEVEVLLPPTVPAGKKSEVTFVLSSAGKKEKQKVSISP
MRQWNVYLYNHSHVDIGYTNTHKNVERLHKTNIIEGVRLAEETKNHPEGSRYVWNPEIGW
PLERLWQSEPERREALIGAVKKGQLCVDASYLNLNTSTCSDEELFHVFKFTREIQRLSGV
PSDVFQQFDIPGVSWGLIPVMAQEGVKYIISWPNSDRAGNAHKYQMDGRPFWWIGPDGES
KVLFFQPGGYANCGSMGKGRTTGRPWFGQRDPEKVPAVIRTGEADVDFTRQLTEMEAENY
PYDFAVFSWTLWDNCPLDADIPYAVKAWNEKYAYPKIKICGGHEIMSMIEEKYGDRLPVV
TGDYTEYWTDGLGTAAGLTAMNRNAKGRLLQAETIWSMLANGTKAPRYDFDEAWRYILLG
SEHTWCFENPTEPYFQDAIWKVKQSYFHEAEDRSIDMLDESLAPVTDKSDGALGPKEGPS
NGGIAVFNTHTWPKSGVITLSSKESLKGDKVVDQDGKEVLSQRLSSGELLFYASEVPALG
SRHYRVVEGKCTLSSRCRINGNTLENEYLTVRLDPVTGNIVYLAKNGSEYNYVNRGANTF
SWLPANVDAPQADTVESVSVVEEGPLAVELRITSKATGCRSVSRSVRLQAGQPWVEISNI
VDKLPLVEKDGIHFGFDFNLPDSKTRVDIPWGMMEVEKDQWPQGNRNWLAMQRWLDVSNS
THGVTWCSLDAPLFEYGDRYANISMSWGGQGNWITKLEPSSTIYSWVMNNHWHTNFPLTQ
DGPVRFRYRLYPHEEYNVVEANRFGLEQSQPLVYATADKARVIKPVITIDNERVYTTILK
STDKDKELIVRLRSLSDKAEPVKLFFPKADPKSLMICEREEIPVKPTNGEFMMKPYGQIT
LKIEY
Download sequence
Identical sequences WP_028729586.1.41584 WP_028729586.1.74405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]