SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_029275591.1.56324 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_029275591.1.56324
Domain Number 1 Region: 55-316
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.64e-16
Family alpha-mannosidase 0.069
Further Details:      
 
Domain Number 2 Region: 452-666
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000157
Family alpha-mannosidase, C-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_029275591.1.56324
Sequence length 895
Comment hypothetical protein [Pedobacter borealis]; AA=GCF_000708285.2; RF=na; TAX=1454007; STAX=475254; NAME=Pedobacter borealis DSM 19626; strain=DSM 19626; AL=Contig; RT=Minor
Sequence
MRLKNYLWKYNILECFIGVILPILFFNQDVMGQDQPKSPIPVPRQPSNLLPGHTSPGVKD
IWIVFKTHCDLGYTMSAKEVLKKYRVDMMDNAIKLIDQERTKESSDRFKWTIAGWPMWGD
ILGDLQTPERKKKIEQALREGYINVHAFPATIHTDVFEAEDYARSLGFSSKVARKYGLKL
PIAAKMTDVPAHSWFLPTLLYHSGIKFLQIGRNYANRGPILPELFWWQGPDGSRILCNYS
TEYGSKLTPPDDWPSKNYLAVSMTHDNEGPPSPGQVEQVKKEAGKIKGAKVHIGTLDDFA
NALLAENPDLPVIKGDMVDPWIHGVMAMPQETKMARNIRPLQPVLDILNTQLNLWKLRSG
SVEDKLAVSYENSMLYGEHTWGAMTPGWGFFSMDGKNMGIERYHYGNDFIRARAEGFYEK
FESSFEEHRRYIKITDSIVSKELDKRLAILAQNVKAKAGEIIVYNTLPWARSGEISIGSK
RIWVNDIPANGYKVIKNDEKNGVALANHPAILDTKYFTVRFDTSRGGIASLIEKSSGKEL
VSKDDNFVLGQFLHEKFSYQQTIDYYNKYCTLSNSFNASVKPNMPKNIPYSAVTLNNWKM
NVVQSSFADIVTLTTGNTQGIAKSVSLRFTFPKAQPFVDVEWRIKDKVPNTLPEGGWLCF
PFNINKPDFKVGRIGGVMDLATDQITGGNRYIYGVNTGAALKEHGGVGVGICAVDAPLMS
FGEPGLWKYDYDYLPKKASAFVNLYNNMWNTNFPYWTEGTWSEKVRIWTVGKNENTAENI
AIKSWEARMPLLSITASGIGAKLPREKSGISVSRKGVLVTAFGADPDGNRGTLLRIWEQA
GIKGKVTINLPGEMSVKSALPVNLRGEITGQKIEVKNNLFSTDLTSFGPASFILN
Download sequence
Identical sequences WP_029275591.1.56324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]