SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_030356907.1.75681 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_030356907.1.75681
Domain Number 1 Region: 121-332
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.64e-23
Family alpha-mannosidase 0.064
Further Details:      
 
Domain Number 2 Region: 561-646,685-1025
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.42e-22
Family alpha-mannosidase, C-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_030356907.1.75681
Sequence length 1060
Comment MULTISPECIES: alpha-mannosidase [Streptomyces]; AA=GCF_000716675.1; RF=na; TAX=67267; STAX=67267; NAME=Streptomyces alboflavus; strain=NRRL B-2373; AL=Contig; RT=Major
Sequence
MTTRALVRTTDWDNDRIRASLRASVVSAEGELNGRVLRLTEEPLMRRAADGTLLQSLRVE
PVNGASVPGELEVRTESGTALRAERVPGPGHAVRLLLPAVTAPTRVTVALPGGAEGIGVP
LTPQRQWTIHLVHHSHLDIGYTDPQGLVLNEHLSFLDSCLELTRTTDDWPAESRFRWCVE
SLWSFKQWARSRPAEQVDELIRRVGEGRIELTALPFNLHTETCSTDELHELLRLAHDIRD
RYGVRFTSAMQTDVPGAVVGLVDALAGAGVSYLSVAHNWAGRSVPHLVGGEKLPRLFRWR
APSGNSVLVWMTDTPHGLAYMEGPLLGFDTAYADVDDLLPAYLTSLASHPYPYRGGIFGW
AMDQQDIKREPYPWDVLHLRVQGKFGDNAPPRRVIADTVRRWNETWAHPRLRLSRNEDFF
LDAEARLGDEIATFEGDWTDWWVDGVGAGAQPLSLARTAQSVVADAQTVGAFASLLDATG
AEDDTRDAAGVYEAVSLFDEHTWGAGDPWTHGDEGGHSGEQQWHWKYGQALRAHDDGTSL
LHRASARLGQRLAAAPGALATYHVVNTCSWPRTDVVRIFLPESSVPLAHAVAVRDGRSGR
RLAHEEEAQTNEDHRDAGRFLVVRIDEVPPAGSVRVEITAADTDAHDAPANAAAKAATGW
NPTGAAERENPADTAAQALAHPDPTLLENEHLAVRVDLAHACVASVIDKSTGRELVRTDP
VVGFNGYFHDSYTTAGGFNHNSSRTTASDRLEHLGTRAVAPPAALIARRSTVTAETLTYE
TRPAGANRLRTTLTLPRGVPRLDIENRLDKDHTLGKESAYFAFPFALDDPVVRMEASGGV
TGTGLPVVPGSARHMRAVRRWVTLADDGCAVAWSSQDAPLVQFGNVALPYAPFPRTMGHD
EPATVFSWIHNNLWDTNFPSGQGFEFTFRYSLACAPTADGLGPRTAAAFSRPLRAVRARG
RVASGAATHAFAEVDDPRVRLVGMTVPRPGEVLLRLQSFANEAVDCRVLTRFPVAAAYRA
DYLGTKGAALGAVDRADGAGAVTTLAVPPLATAALLLVRP
Download sequence
Identical sequences WP_030356907.1.25257 WP_030356907.1.68619 WP_030356907.1.75681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]