SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_030669426.1.32570 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_030669426.1.32570
Domain Number 1 Region: 119-331
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.93e-24
Family alpha-mannosidase 0.038
Further Details:      
 
Domain Number 2 Region: 560-646,685-1024
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-21
Family alpha-mannosidase, C-terminal domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_030669426.1.32570
Sequence length 1054
Comment alpha-mannosidase [Streptomyces sp. NRRL B-1347]; AA=GCF_000720325.1; RF=na; TAX=1476877; STAX=1476877; NAME=Streptomyces sp. NRRL B-1347; strain=NRRL B-1347; AL=Contig; RT=Major
Sequence
MTTRALVRTADWDNDRIRASLRSGVVAADGTLDGAALRLSEEPLLREAADGTLLQSLRID
PVNGSRVPGELAVRTGSGAAVRAERVAGPGGGARLLVPAVDTATRLTVGLPQGSDGITVQ
LTPQRRWTVHLVHHSHLDIGYTDPQGQVLNEHLSFLDSCLELTRATDDWPSESRFRWCVE
SLWSFEQWAAARPAEQVEELMRRVREGRIELTAMPFNLHTETCSTDELHELLRLAHGVRE
RHGVTLTSAMQTDVPGAVVGLVDALAQAGVRYLSVAHNWAGRSVPHLVGGERLPRLFRWR
APSGASVLVWVTDTPHGLAYMEGPLLGFDTSYADVDDLLPAYLTSLATHPYPYRGGIFGW
AMDHVDVKREPYPWDVLHLRVQGKFGDNAPPRRVIADTVRRWNETWAYPRLRLSRNEDFF
RDAEARIGGEIRTFEGDWTDWWVDGVGAGARPLSLARTAQSAVADAQTIGTFAALLDATG
AEDDTRDAAGVYEAVSLFDEHTWGAGDPWTHGDEGGHSGEHQWHWKYGQAMRAHDDGRAL
LRRAGARLGQRLAAAPGAVATYHVVNTCSWPRTDVVRIFLPESTVPLDRPVTVHDARDGR
ALTHEERPQTNDDHRDAGRFLLVRVDEVPSAGSVRLDVRAAGGKAERRGTPAAVKAATGW
NPTGGTERDDPAESAARAAAHPDPTLLENEHLAVRVDLAQACVASVVDKATGRELVRADA
IVGFNGYVHDSYTTAGAFNHNSSRTTASERLEHLGRRAVAPPAALIDRRSTATAESITYE
TRPAGANRLRVTLTLPRGVPRLDVENRLDKDRTLGKESAYFAFPFAFDRPVVRMEASGGT
TGTGLPVVPGSARHMRAVRRWITLADDGLAVAWSTQDAPLVQFGNIALPYAPFPKTLGHD
EPATVFSWIHNNLWDTNFPSEQGFETTFRYSVACGPTATGLGTRTAAAWSRPLRAVRARG
ATGVAPASHCFITLDDPRVRLVGATTPRAGEALLRLQSFAEERVACRVRIGFPARAAHRA
GYLGGRGPELPLEDGEVSVDVPALGTAAVLFVRQ
Download sequence
Identical sequences WP_030669426.1.32570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]