SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_032439203.1.31459 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_032439203.1.31459
Domain Number 1 Region: 148-253
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000432
Family Myosin rod fragments 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_032439203.1.31459
Sequence length 267
Comment hypothetical protein, partial [Klebsiella pneumoniae]; AA=GCF_000694515.1; RF=na; TAX=1438787; STAX=573; NAME=Klebsiella pneumoniae MGH 64; strain=MGH 64; AL=Scaffold; RT=Major
Sequence
MNRAATLTLNAPLLMLVAALALSTPFTAGAAPAFLDYAQQQTQQSQAQEKNDAASAKQTQ
ENRQSADNKKTGTSTSQLQKRITSQQAAIAQKDKLIQQLKKQLAATPQTDTAGANEQAAL
NKRINELQVALSAATAEKEALIKKAGVVQNNNLKQSQAAARQQIQQLTTQIQQAEAENKR
LSASFTTLNKDKHALMTRLAAAEKEKQAALEQVKALNADKQPLTTRLAAAEKEKQAVLEQ
VKALNADKQSLTIRLAAAEKAQQAALD
Download sequence
Identical sequences WP_032439203.1.31459 WP_032439203.1.59559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]