SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_032855831.1.44367 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_032855831.1.44367
Domain Number 1 Region: 121-206
Classification Level Classification E-value
Superfamily PKD domain 4.97e-21
Family PKD domain 0.0021
Further Details:      
 
Domain Number 2 Region: 234-554
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.35e-17
Family Quinoprotein alcohol dehydrogenase-like 0.0029
Further Details:      
 
Domain Number 3 Region: 33-119
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000379
Family PKD domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_032855831.1.44367
Sequence length 587
Comment hypothetical protein [Bacteroides ovatus]; AA=GCF_000178275.1; RF=na; TAX=702443; STAX=28116; NAME=Bacteroides ovatus SD CMC 3f; strain=SD CMC 3f; AL=Contig; RT=Major
Sequence
MNRMIMKKYIFLIVTVVCLFACKDGDEVRQTTSPEASFSIDKEEYTVGDIVYLTDESVKT
EGEIVEYFWHFGFEGEGNRATTKDASVLYKRAGTYVIKLTVTDEFGGYATASHTVVIRPT
NMPPVTNFSYSPAICKVNEKVQFTDKSVDEDGEIVSYEWDFGNGQTSQEKDPEITFTTTG
FVTVKLTATDDRGATNTKQATLYVRDTSISGVTVLWDKTFEVSSSLRSISPAVGDNGDVY
VSSNALHLFAYSPSGEQKWMFDLSKDGGAGNQGSSPMVGADGTIYMGASTTDKNISSSLY
AIHPDGTQKWRYELGIGTNIPYISPALSRDGNILIGNRGTDGSVHMVDRSSGRQFWRRKS
PNGGANGGISVGQNGVIYSALSGANGFARTTQDGVNLSPNLGKGNTAAAVYPAIDAQGNV
YVAFSEGVVAAYDNQGNELWRYPASGTMGKIDQGGPAIGADGTIYVGTKNPNAQVVALTK
GGAKKWSYSSVAEIGTTPAIDSDGNIHICDDGGNYIILNADGTEKYKRQLGSKIWSSPVI
ADYGIVYVTYEDNGACKLIAIDCGIEGPANSPWAQRGQNAKRNALQK
Download sequence
Identical sequences WP_032855831.1.44367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]