SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_033699445.1.25404 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_033699445.1.25404
Domain Number 1 Region: 187-371
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.24e-64
Family Methylesterase CheB, C-terminal domain 0.00000722
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily CheY-like 7.68e-28
Family CheY-related 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_033699445.1.25404
Sequence length 373
Comment MULTISPECIES: chemotaxis response regulator protein-glutamate methylesterase [Pseudomonas]; AA=GCF_000763225.1; RF=na; TAX=658612; STAX=658612; NAME=Pseudomonas sp. H2; strain=H2; AL=Contig; RT=Major
Sequence
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPEKVKQ
LLCEKVHTLSRSNRRFGSYSPAPAAAPAAASSAAPTSSFASPAPVRTAAPVRAAAAPAAH
APAPKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKL
CKISVKEAEDGDVLRPGLALLAPGGKQMMIDGRGTVKILPGDERLNYKPCVDITFGSAAK
SYGDKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAVYS
LDEIGKHLVEACV
Download sequence
Identical sequences A0A084CIK8 A0A099E0J2
WP_033699445.1.25404 WP_033699445.1.75421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]