SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_034044680.1.84713 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_034044680.1.84713
Domain Number 1 Region: 748-1201
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.51e-41
Family alpha-mannosidase, C-terminal domain 0.037
Further Details:      
 
Domain Number 2 Region: 352-534
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.02e-26
Family 4-alpha-glucanotransferase, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_034044680.1.84713
Sequence length 1203
Comment hypothetical protein [Flaviramulus ichthyoenteri]; AA=GCF_000789235.1; RF=representative genome; TAX=1380600; STAX=1230531; NAME=Flaviramulus ichthyoenteri Th78; strain=Th78; AL=Scaffold; RT=Major
Sequence
MNTLKKCLKPLYGKISLIILCLLSLSIGATEKNNISINSVNGVKPLHGGGGHSHIYEVNT
KYNLYSLSKNDIEGYSEKISGRDYTYQSIREDVTKALISRASDGKLAFEVLLNKIPENYT
KKEVSFFFYSNIDLNIREPFDLFINDNLAITFIANEDGTLKILNNPVNAIAEYILVKRDE
NKDGVGAFRLTVPTELIGKGNQAKMKILGHKKGSRSWFMIFKTNNVLEWLKISAKNEAAF
SIKQSESGLHIDAPAHFGGKTVYIKSDGKTSKKATFKTYGNLAKATIEIDAPKEHFKLFY
GDDVVEVTFENKNGTCTISDVIGTFFYHYNIQNKGKWTAEITKLYEPSLFNTYTDFFDKK
HEDGTVSIVNSSHQDIAWMDRPEVCIILRDTLVLTPVINDAFIKEDYGFDIEDGLMLREY
VDRHPESVDKITTLLNKKLISVGASYNCPYEDMYDAEDLVRQFYLGKKWVKKTFGGYDSK
VYWNVDVPGKTMQFPQILKKAGVDYMIISRHGKGMFNWESPDGSSVFTYSSGHYGDDFVQ
LSKDLTNKIKYGAEQVTYWSQYYKDSKTVTPLLSSYDMIPAIDYTDFVKAWNGFEKVKDN
NNKEIPVYLPSMDIMTSDEFMPLAEKNATSIETIKGERPNVWVYIHGPAHHEAITASREA
SKLLPAAEKFLSIANTMDPARAPYPFKEFDEAWQAKIYPDHGWGGHDGDITDDLFKAQFV
KSRTMGSKLLNKGTDFIANRIKTKESLGTPVVLFNSLSWERTDPVTVSVNFTKGKAKSLN
VVNSKKEKIASQIVKAEYFDDGSIKNADIVFIAKNIPSIGYKTFYIQQSLETPNSITKKV
STSNYENEAYKISFEKGGIAQIYDKELKRNLFKTDKFKGAEVFTLYSNGNGAGEFGDIQQ
PFMQDFDKVSTHNPTWEIVTNGNVYTTYRIKQPILHAIVQQDVTIYHELKRVLFETELLN
WDGTLYREFRTAFPIAIDNALVTHEVPFGSVKVGQDEIHTAGDRYTALCKDVHPRAIMDW
FSASDDDMTVTLSSSVAAVDWIDPTSDNSDTVLQHLLLASRTSCHWEGNEYSQEGSHSYH
NILTSNKTGDVSGKQMAKQHNEPLHVTVFPDKSINAFLPETASFFNIDKENVIVSTIKKA
EDTDELVIRMFDTEGENSTVDLKSYFKINNFKQTNIIEENPVPVKDLKVSKYGIETFTFK
TKN
Download sequence
Identical sequences WP_034044680.1.84713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]