SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_034589386.1.20517 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_034589386.1.20517
Domain Number 1 Region: 1-186
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_034589386.1.20517
Sequence length 186
Comment pyruvate ferredoxin oxidoreductase [Helicobacter magdeburgensis]; AA=GCF_000765825.1; RF=na; TAX=471858; STAX=471858; NAME=Helicobacter magdeburgensis; strain=MIT 96-1001; AL=Contig; RT=Major
Sequence
MLEIRWHSRAGQGAVTGAKGLADVIAGTGKEVQAFAFYGSAKRGASMTAYNRIDSEPILN
HEKFMNPDYILVIDPGLVFITNICLYDKPSTKYIITTRLSKEELIEKKPELATKELYTLD
CIQISIDAIGKSVPNAPMLGALMKVSGMLEIDYFLESFSKVLGKKLPQKVIDANKVAIRR
AYEEVK
Download sequence
Identical sequences A0A099U1I1
WP_034589386.1.20517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]