SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_034871636.1.92469 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_034871636.1.92469
Domain Number 1 Region: 656-935,975-1060
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.57e-29
Family alpha-mannosidase, C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 272-557
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000667
Family 4-alpha-glucanotransferase, N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_034871636.1.92469
Sequence length 1096
Comment MULTISPECIES: glycoside hydrolase [Elizabethkingia]; AA=GCF_002024805.1; RF=na; TAX=1756149; STAX=1756149; NAME=Elizabethkingia genomosp. 3; strain=G0146; AL=Complete Genome; RT=Major
Sequence
MAGNFIYAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGAKTIEW
ETAKVPQKNSGPYIYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQHPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPINKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDASATPFILKDGKRLINLTTLHFGPEEKITAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNVQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALRMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKDGGIGLSVMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWLSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDQLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNSQHFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLDGNSLANQLEK
DLLQPLTNPGSKKIEVFNTSSWTRNGVATIPATAEGNSVQDAAGNKIPLQKLENGTMVFM
AKNIPALGSAVYTIIKNKTLATTPFVVTNNSVSNGKITLTWDNKTGSITHFTDNGTTNYA
GSFKNQGLNSYWYVPGSDPNEAKSNTEVQTKILENGPVMVKVLLTADAPGANKLERIITL
YKDSDEALLENIIDKKPVRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDKGTLGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDTFNSVENEKYAAAFTQPLIAIPVIEKADIKGSL
FHMKNDKIVVTSITPQNDQSFIIRLYNPDEKEQTTTFTWERLKPSKLIYNKTGKEIFIND
SVSLNSMDVIEIKVIP
Download sequence
Identical sequences WP_034871636.1.22592 WP_034871636.1.60187 WP_034871636.1.82263 WP_034871636.1.92469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]