SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_034967195.1.45856 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_034967195.1.45856
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-37
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_034967195.1.45856
Sequence length 183
Comment 2-oxoglutarate:acceptor oxidoreductase [Campylobacter mucosalis]; AA=GCF_000705255.1; RF=representative genome; TAX=202; STAX=202; NAME=Campylobacter mucosalis; strain=DSM 21682; AL=Contig; RT=Major
Sequence
MKSELRFVGVGGQGVILAGEILAAAKIESGGYGVKASTYTSQVRGGPTKVDIILDESEIL
YPYANEGEIDFMLATAQVSYDAFKSGVKEGGIIVVEPNLVKPSDDDKKRYKIYEIPIITI
AKEEVGNVITQSVVALGVAVAMSKCIDENIVKESMLSHVPAKVKEANEKAYELGLKYAKN
LIA
Download sequence
Identical sequences A0A071LQH9
WP_034967195.1.45856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]