SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_035357021.1.3064 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_035357021.1.3064
Domain Number 1 Region: 510-959
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.38e-36
Family alpha-mannosidase, C-terminal domain 0.028
Further Details:      
 
Domain Number 2 Region: 115-339
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000000328
Family alpha-mannosidase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_035357021.1.3064
Sequence length 964
Comment hypothetical protein [Edaphobacter aggregans]; AA=GCF_000745965.1; RF=representative genome; TAX=1121860; STAX=570835; NAME=Edaphobacter aggregans DSM 19364; strain=DSM 19364; AL=Scaffold; RT=Major
Sequence
MKRRDLLKSLSMAAGGMLWTRNLAGQSSQGESKAKARLATPIRALARKNGQVYQPLEIHL
EDTALSGEAVTKLDGVEVDRRNVETGSHTFDIYLKPVNQPKQSTVTVEIIGKAFTDQVEL
KPVRKMLVYVLPHSHHDLGYTDLQADVEQKQIRNITRGIELARKTADYPEGSRFVWNLEV
LWGADLYMRRSDESARRALIEAVQKGWIGINGSYANELTGLCRPAELLQLFRYSGELGNT
CGAKVDSAMMSDVPGFSWGTVTAMSQAGIRYFSAAPNYFDRIGTFMVTWQDKPFWWVSPS
GKEKLLFWVPWTGYALSHVMKLGDELVSKYQDRMDEVHYPYDISYIRWSGHGDNAEPDPE
LSDWIRDWNQKYEWPRFSIASTSTAFSAFEKRYGNQLPQYRGDLTPYWEDGAGSSALETA
MSRNAADRINEAAALTALGKINAYNPSSYAEAWRDVLLYSEHTWGAWNSVSDSENPFVKK
QWDVKRAFAVDADKLSKDILAQAGGAQATESSANAIEVHNPSSWSRTEIVYLSHELSSAG
DRVTDSRGKPVPSQRLSTGELAVLVKDVPAFAAASYRLSPNKALAPNTPVSYKDHRLSNG
VLELSIEPSTGDVSALRLHGEQQNLADNRKHRLNQFLFLQGKDVDHLQSSSTATIVVEEQ
GPLLVSIRIESSALGCKSLVRRIRLSAGADYVEVANTVDKLRAPLNPHPGVGGPGDEFAQ
RGSKESIQFAFPFAVPDGKMTLDIPLGNMRPEADQLPGSCKNWLPVGRWVDVSNESLGVT
WITQDAPLVEIGEISATMLGSQRDPSVWRKHIDETQTFYSWVMNNHWGTNYLAYQEGPTT
FRYALRPHRKHDASAASRLAIALSEPLLSRPSDSVSQESESLLRIEPAEVIAITLKPSED
RKAWIVRLFESSGQPRSAKLTWAASQAVQSWRSNLAEEKLEPVGNEVHLDGWELLTLRVE
KKAP
Download sequence
Identical sequences WP_035357021.1.3064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]