SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_035425393.1.42074 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_035425393.1.42074
Domain Number 1 Region: 283-447
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000049
Family Tropomyosin 0.0046
Further Details:      
 
Domain Number 2 Region: 748-889
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000916
Family Tropomyosin 0.0026
Further Details:      
 
Domain Number 3 Region: 830-1034
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000123
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_035425393.1.42074
Sequence length 1189
Comment hypothetical protein [Atopobium fossor]; AA=GCF_000483125.1; RF=representative genome; TAX=1121023; STAX=39487; NAME=Atopobium fossor DSM 15642; strain=DSM 15642; AL=Scaffold; RT=Major
Sequence
MKKSTQAIAVATSAITVMSSMPVGAFAQQDSENPTPPVSMAVSTADSTSPKTHIDRTPAN
NLAAAQAVLDEAKQFSSEAQQGMQKAQQAYDEAAASEQTHKEKKIASDTAVVEADHAGAQ
AVQDIKTNADKKFLEASQLVDQQKQEVDKARQELEQAHAQEKQAQQAKKKAEEELAAAQK
ANPEASKQIEEKNTQIATLEQELARKTKDHSTAAEAKKQAEQLVKQAEDAYSQKNAEHAA
ATQKVEEATAARNQAQARVTDLQARYEAAKKAAENGSQQGDEAALQQVKEAQELVTARQA
QLNQANQALSAAASTLKDAEAQLNTHKHALDEATAALQTQEQEVQKATDALKTAQANRQQ
AGSTVLGLQDRLKDAEDRLKDARQRVTQAESKIAQAEQSLDTLTKQLEEARKERDAIQAR
LKNTSDSSAGNTEAAKKARSSRGFFEHNGSTIAAQTFDQTTPYSVDAWKSDWSGKERMQG
ARAEDFTHVGEKGDATTLDNMRDALMLLKNAAYVHDKMPLDDDIQEGTQNKWYVSDAMMA
RAQVNANFSRNVMYHLGSASTKSGAHSTDTEPIQAHETGEILAWDRYNVNGTGMTEDTWK
LNNTGDKLKANTKTDTYYKDSPVFAWYQFEANTYYETQRNKDQDGDNVIGQTSYTPKNGS
ATDRQTGHYTFFRDNPQYKGKMAMGAAVTTYNKDRSAGRLVHDAEIIDSYYAEQYRAKPQ
SDPSFKLYTIDDYIARLDSYINSLKTGNNQQDKDALIEVNNRIADLEKQIKEKESDRNLA
QSQSTEAASAVQSGEKEVDNLIQQLQAATNRRDNAQRTVNQRENQLKAAQEKQQQLVEQK
EQAQQKVQEAQQTVDSQKSFVEQLQSKATEAQKNLQEAQAKLAQAQQQAHDAAGLVETLK
KQLDEAKDELSQKEQELVKLTQQQNQAQKQREDAQQQLNAQKQKLNDATADEQLKANELA
QAQAEITTLTKQRDDLIAANDRITQAQAGVKQASKQLQDATAQVATLQLAVDAQDKKLTE
ARAQLLAAQTAVDEAKTLDWDVDKNKQDDNPTAFANINTLIKDLHARHQEASAASLAYTQ
SVNQLQDAMAVLGTARQYLAEALADQAWAQDQVNRLTAKPAVQPDDSANQSTQVVDKTPQ
HMADSHMQAKQGSLPKTGDTSADLAFGMSAAGAVTIAGLALKFRKKYEE
Download sequence
Identical sequences WP_035425393.1.42074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]