SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_036118296.1.90735 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_036118296.1.90735
Domain Number 1 Region: 423-504
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000275
Family Anti-sigma factor antagonist SpoIIaa 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_036118296.1.90735
Sequence length 540
Comment sodium-independent anion transporter [Mangrovimonas yunxiaonensis]; AA=GCF_000733475.1; RF=representative genome; TAX=1197477; STAX=1197477; NAME=Mangrovimonas yunxiaonensis; strain=LY01; AL=Contig; RT=Major
Sequence
MASFIIKRTANVKNDVLSGITVALALVPEAVAFAFVAGVDPLVGLYAAFMIGLITAVFGG
RPGMISGATGALAVVMVSLVAEGNAMGAESENLGLYYLFATVILMGIIQMLAGVFKLGKF
VRLIPHPVMMGFVNGLAIVIFLSQLGMFKEVVNNEVVWMQGPRLWIMIALVALTMGIMYG
LPKLNKKLPEALIAILVVSAIVIFGGLEAATVGSFIRDGGGEGLKGGLPIFQADIFTKVP
MTWETLKFIGPYALILAAIGLIESLMTLNLIDELTETRGNTNRECLAQGGANIVTGLFGG
MGGCAMIGQSIINIKAGGRTRLSGIVAALGLLFFILFASGLIEQVPIAALVGVMFMVVIG
TFAWSSFRIVNKIPRSDLFVLVLVSGLTVIFDLAVAVIAGVIISALVFAWENAKRIRARK
RFKTDGTKVYEIWGPLFFGSVKAFNEKFDVKQDPDKVEIDFIESRVSDHSALEAIFNLVE
KYEAVGKKITLKHLSEDCKVLLYKASPKFKDVIEEAIDDPRYHLAENPEAFPKPLSEYKF
Download sequence
Identical sequences A0A084TNP4
WP_036118296.1.90735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]