SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_036145813.1.81564 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_036145813.1.81564
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.47e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_036145813.1.81564
Sequence length 120
Comment RsbT antagonist protein RsbS [Lysinibacillus sp. BF-4]; AA=GCF_000743635.1; RF=na; TAX=1473546; STAX=1473546; NAME=Lysinibacillus sp. BF-4; strain=BF-4; AL=Contig; RT=Major
Sequence
MSLKVPILKLYDCLIVSIQWELDDHMAMMFQEDLLSKLYETGARGVVLDLTFVDFMDSYI
AKVIGDAINMATLMGAKLVLTGIQPPVAITLVELGISLNASSTALDLEKGLEQLQRELGG
Download sequence
Identical sequences A0A078MGQ5 A0A087N0V1
WP_036145813.1.81564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]