SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_036344385.1.28968 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_036344385.1.28968
Domain Number 1 Region: 238-497
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.82e-60
Family PFOR Pyr module 0.061
Further Details:      
 
Domain Number 2 Region: 20-227
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.54e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 
Domain Number 3 Region: 513-616
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.67e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_036344385.1.28968
Sequence length 648
Comment 2-oxoglutarate ferredoxin oxidoreductase subunit alpha [Mycobacterium aromaticivorans]; AA=GCF_000559085.1; RF=representative genome; TAX=1440774; STAX=318425; NAME=Mycobacterium aromaticivorans JS19b1 = JCM 16368; strain=JS19b1; AL=Contig; RT=Major
Sequence
MGPNGNGAAGNRQKLEKVVIRFAGDSGDGMQLTGDRFTSEAALFGNDLATQPNYPAEIRA
PQGTLPGVSSFQIQIADYDILTAGDRPDVLVAMNPAALKANIGDLPRGGLVIANSDEFTK
RNLAKVGYESNPLESGELDDYVVQAVAMTTLTLGSVEAIGASKKDGQRAKNMFALGLLSW
MYGRPIETSETFIREKFARKPDIAEANVLALKAGWNYGETTEAFGTTYEISPAKLAPGEY
RQISGNTALAYGVIAAGQLADIQVVLGTYPITPASDILHELSKHKNFNILTFQAEDEIAG
VGAAIGASYGGALGVTSTSGPGISLKSEAIGLAMMAELPLLVIDVQRGGPSTGLPTKTEQ
ADLLQVMFGRNGESPVAVLAASTPSDCFEVAIEAARIALTYRTPVILLSDGAIANGSEPW
RIPDIDSFKPIDTNLAEAGEDFQPYARDPETLARQFAVPGTPGLEHRIGGLESANGSGAI
SYEPANHDLMVRLRQAKIAGITVPDVTVDDPTGDAELLILGWGSSFGPIGEACRRARRRG
IKVAQAHLRHLNPLPANLGEVLRHYKNVVVPEMNLGQLALLLRGTYLVDVQSVTKVEGMA
FLADELEGIIDAALDGTLAEKESDKAKFARLAAATVGTGTDVGAGVNA
Download sequence
Identical sequences A0A064CPD3
WP_036344385.1.28968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]