SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_036717829.1.41118 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_036717829.1.41118
Domain Number 1 Region: 156-339
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.75e-57
Family Methylesterase CheB, C-terminal domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily CheY-like 3.56e-26
Family CheY-related 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_036717829.1.41118
Sequence length 347
Comment chemotaxis response regulator protein-glutamate methylesterase [Paracoccus sphaerophysae]; AA=GCF_000763805.1; RF=representative genome; TAX=690417; STAX=690417; NAME=Paracoccus sphaerophysae; strain=HAMBI 3106; AL=Contig; RT=Major
Sequence
MRPVRVLIIDDSMTMRRLIRLALSGDPRIDVVGEARDAQQARERLGELRPDVLTLDVEMP
GQSGLDFLERLMAVRPMPVIMVSTETHHGTAAALEALSMGAVECVGKPVNAAAAADFAML
PDLVVAASTALIAPRPAGHQRPAGTPPPTGFIWNGRFVLIGSSTGGVDALERILSEYPSN
CPPTVITQHMPAGFLTSFAQRLNTRIRPTIQLASTGAPLLPGNVYLAPGGDTHLAISSPR
APVCHLVDADKRNGHRPSVDYLFETGAQLGDKAIAVMLTGMGRDGADGMLAMRRARAICL
AQDEATSVVWGMPRVAWESGAVDRLVPLPEIATQILSAAGRAMRAAS
Download sequence
Identical sequences A0A099FD84
WP_036717829.1.41118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]