SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_036756710.1.33314 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_036756710.1.33314
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-41
Family Sfri0576-like 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_036756710.1.33314
Sequence length 126
Comment STAS/SEC14 domain-containing protein [Photobacterium galatheae]; AA=GCF_000695255.1; RF=representative genome; TAX=1654360; STAX=1654360; NAME=Photobacterium galatheae; strain=S2753; AL=Contig; RT=Major
Sequence
MQTTHGLFFEVDRDGDHFFMELKAVGKLTHEDYEQITPLIDEALAGIEHPKVNVYFDGSD
FEGWELKAAWDDLKLGLKHGKKFNRIAIYSDKKWMDVMAKVGNWFISGEVKCFDTPVDAL
AWLREE
Download sequence
Identical sequences A0A066RQV2
WP_036756710.1.33314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]