SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_036865103.1.62975 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_036865103.1.62975
Domain Number 1 Region: 2-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.44e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_036865103.1.62975
Sequence length 180
Comment 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella melaninogenica]; AA=GCF_000759305.1; RF=na; TAX=1401073; STAX=28132; NAME=Prevotella melaninogenica DNF00666; strain=DNF00666; AL=Contig; RT=Major
Sequence
MKKEIIISGFGGQGVLSMGKILAYSGLMEDKEITWMPAYGPEQRGGTANVTVIISDDRIS
SPILSKYDVAIVLNQPSLDKFEPKVKPGGLLIYDGYGVFNPPTRKDITIYRINAMDKAAE
MKNAKVFNMIVLGGLLKVCPVVSTDGLKKALFKSLPERHHKLIPLNMEAVEEGMKIIAQQ
Download sequence
Identical sequences A0A096AJZ6
WP_036865103.1.62975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]