SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_038605281.1.97771 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_038605281.1.97771
Domain Number 1 Region: 12-74
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000392
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_038605281.1.97771
Sequence length 380
Comment ABC transporter permease [Pseudomonas alkylphenolica]; AA=GCF_000746525.1; RF=na; TAX=237609; STAX=237609; NAME=Pseudomonas alkylphenolica; strain=KL28; AL=Complete Genome; RT=Major
Sequence
MEPMTTQASATLDTTSNPACLRIVGDWTLANYASLKRSSERLAGQYDQRTEIDLEQLGQL
DTAGASLLAELLGAERLSRLTETAQLPEASRALLQAVYCSVQDFCIPEKQPEKSVLIQLL
SRIGCAVDTLWQDTLQILGFVGLILQTLVLRLFQPRRWRVTAVVAHIEQTGLDAAPIVAL
LTFLVGAVVAFLGATVLAGFGASIFTVDLVAFSFLREFGVLLTAILMAGRTASAFTAQIG
SMKANEEIDAIRTLGLDPVELLVVPRVLALLIALPLLTFLAMICGIIGGGVVCALSLDIS
PAMFLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQS
IFVVIVLDAVAALFFMEMGW
Download sequence
Identical sequences A0A077F7T9
WP_038605281.1.97771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]