SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_038664660.1.50587 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_038664660.1.50587
Domain Number 1 Region: 398-485
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000165
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_038664660.1.50587
Sequence length 495
Comment sodium-independent anion transporter [Pseudomonas stutzeri]; AA=GCF_000661915.1; RF=na; TAX=316; STAX=316; NAME=Pseudomonas stutzeri; strain=19SMN4; AL=Complete Genome; RT=Major
Sequence
MLQSIKQNWFSNVRGDVLSGLVVALALIPEAIAFSIIAGVDPRVGLYASFCIAVVIAFTG
GRPGMISAATGAMALLMVTLVREHGLQYLLAATLLCGVLQIVAGYLRLGSLMRFVSRSVV
TGFVNALAILIFMAQLPELTNVTWHVYAMTAAGLGIIYLFPYVPKLGKVIPSPLVCILSM
TAVAVYFGLDIRTVADMGDLPDTLPVFLWPEVPLTFETLAIIFPYSAALAVVGLLESLMT
ATIVDDLTDTGSDKNRECKGQGVSNIVSGLFGGMAGCAMIGQSVINVKSGGRTRLSTLIA
GVVLLLMVVFLSDWVGQIPMAALVAVMIMVSIGTFSWDSLRNLKKHPLSTNIVMVVTVVV
VVFTHNLAYGVLAGVLLAAMFFANKVGHYLHIGSELDATGNQRTYMVIGQVFFSSSDKFT
GAFDFKEALGKVTIDLSRAHFWDITAVAALDKVVIKFRREGTEVEVLGLNEASATIVDRF
GVHDKPEAIDKLMSH
Download sequence
Identical sequences A0A023WX68
WP_038664660.1.50587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]