SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_039253997.1.87003 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_039253997.1.87003
Domain Number 1 Region: 164-346
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.31e-62
Family Methylesterase CheB, C-terminal domain 0.0000189
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily CheY-like 1.71e-27
Family CheY-related 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_039253997.1.87003
Sequence length 353
Comment chemotaxis response regulator protein-glutamate methylesterase [Clostridium novyi]; AA=GCF_000768605.1; RF=na; TAX=1444289; STAX=1542; NAME=Clostridium novyi A str. 4552; strain=4552; AL=Contig; RT=Major
Sequence
MEKIKVIVVDDSALMRKIISDIINLQNDMEVICTARNGEDLIKKLENQKPDVITLDIEMP
KMNGMQTLQQMKLKKYNIPTIMLSSVSKEGTKLTMECLHNGAFDFIAKPSGAISLDIEKV
GDELVSKIRLTKGKNSFEVKTNINKNTLLKNKTRRVARKIGTSNIEAVVIGASTGGPKAL
YKVITGLPEKLGVPVFVVQHMPVGFTKAFADRLNANSKIEVIEASEGDVIKKDVVYIAKG
GLHMEVTKDKKIHLSSEPPIWGVRPAVDKLFISAAKVYSANILSIVLTGMGKDGSEGTKV
IKDMGGVTISQDKDTCTIYGMPKAAFETGKVDYVLPIYEVSEAIVKNTVGSGR
Download sequence
Identical sequences A0A0A0I8W7
WP_039253997.1.87003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]