SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_040643452.1.31317 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_040643452.1.31317
Domain Number 1 Region: 1096-1393
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.05e-30
Family Quinoprotein alcohol dehydrogenase-like 0.0085
Further Details:      
 
Domain Number 2 Region: 867-960
Classification Level Classification E-value
Superfamily PKD domain 0.0000001
Family PKD domain 0.0078
Further Details:      
 
Domain Number 3 Region: 679-773
Classification Level Classification E-value
Superfamily PKD domain 0.000000137
Family PKD domain 0.014
Further Details:      
 
Domain Number 4 Region: 962-1055
Classification Level Classification E-value
Superfamily PKD domain 0.0000212
Family PKD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_040643452.1.31317
Sequence length 1413
Comment hypothetical protein [Pseudoalteromonas tunicata]; AA=GCF_000153245.1; RF=representative genome; TAX=87626; STAX=314281; NAME=Pseudoalteromonas tunicata D2; strain=D2; AL=Scaffold; RT=Major
Sequence
MHTHIAFRILFFCGVLQLIGCGDGTEKSESIPQPSKSNTYTLSGGVAKGALINATIKIFL
LDEGGNISDPTPVLITQTDELGQFVSQIPVSDKPRLIQSFGGSYIDEADQEPDVALKRRI
NFESEQGLSSIIFPNQTSVALTIASTAIIKKTKAESTSNNFFSTLALNQQNAVRAFGFDV
INVVPADTLSPAATASTSQLQYALVLGGLANLVNRIALELGFAEPNFDTILAIIDDLSDG
IIDGQYQGVPLSYTNKYGVQQTLPQDIDFNEQISRFKNNNTDNFSTTPTFEVNEEVLKEP
QITNIAPEISVSSSVSLTGQQSLNITASITDPDGSITDFSWQQTAGPTLALTGTNSLTLG
ITAPDVVLDSQATLTLSATDNLGAVSVKQITVEIIARNRAPEIALTTSIKANEQELVSID
ATITDSDGTITDITWTQTSGPSVNLNGSSTSSIRFTAPIVLIQTDIVLKVQATDDEGEST
TATTTITIVPINSPPAVFAGNSQVIFSEKSATLIGQASDEDGTIVSINWQQISGPSALIS
NATSLETLITAPKVTLISDLLFSLTATDNEGASSTAQVSVIVKPLIPPVVFAGEDQIVES
NTSVSLTGLATDSDGIIASYQWVQLSGPTVNLSNTSTANTTFLAPTVTTKQLLVFSLTAT
DDSGASGSDSIQITVEPPNQIPTINAGTDQTIHSALMVTLSGTASDTDGSIASYAWSQTA
GPAVTLSTPNAAVTNFTAPTVSSDTILTFTLTVTDDDGATASDSVQVTVQPPNIAPVITL
NSSQSVERNQSISITASASDSDGTIKSYAWQQTSGQTVSVSGKTTSTISFIAPNISTDTT
LTFSLTVTDDDNASSSANTSVLVFVPNTPPTVNAGADQTLHTGRTVTLSGSASDDGSIAS
YLWTLVSGNLSVTLANPNSAITTFYAAGVEVDETLIFRLTVTDNSGLTGSDTVSITIQPP
NNNPSVNAGADTTAISNQTITLNGTASDSDGTIASYTWTKIVNGSPEALSNANNANLTIT
TPDPSNGETLTYKLTVTDDDGATAEDSIDVVVYSPRFNWSFATAAAINSSPAIDSSGNVI
FGSDDNKLYALDSSGNKLWEFATANKITASPLIDDTDNIYIGSQDKKFYKIDNTGTQLWQ
QTTANPILVEAALLASDNLLFVSDSTINVVDSSGSAVWNFTHPSTNSYSAAISSSSDNVL
IISSDKYLYEFSYSNGSSGPQDSELTPAITNSSPIADNTYVYFGASDSNVHTYGYNEGFY
SYWQSPFTTTAAVYSPAILSTNSDVYIGSTDNIFYAIDSSGSELWRFTTNGAIYGSALLL
NDGSTNNLVIFGSSDGYLYALNAADGVLVWKFKSGGAIKSSPNFKGNNIYVTSTDGKIYC
ITISGYTLATSSWPMFRRDPKHQAKLSSQALGG
Download sequence
Identical sequences WP_040643452.1.31317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]