SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_042612515.1.1957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_042612515.1.1957
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.89e-53
Family Methylesterase CheB, C-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_042612515.1.1957
Sequence length 189
Comment chemotaxis protein CheB [Stenotrophomonas maltophilia]; AA=GCF_000834105.1; RF=na; TAX=40324; STAX=40324; NAME=Stenotrophomonas maltophilia; strain=ZBG7B; AL=Contig; RT=Major
Sequence
MDGPVPRLLVIGASAGGVSALQRVLGALPAALPCPALVVLHIPRDRPSRIAELLDPGSAL
RVREAEDKQPLEVGTVTFAPPDYHMLVEDEGSIALSLDEAVLFSRPAIDPLFESAAAVFG
ADVLAILLTGASSDGSEGVAAVRQAGGQAWLQCPEDAEAPMMPASALQRAGADAVLTLDE
LCECLKELK
Download sequence
Identical sequences A0A0D0JQC7
WP_042612515.1.1957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]