SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_043797852.1.3990 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_043797852.1.3990
Domain Number 1 Region: 540-709
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.84e-23
Family Methylesterase CheB, C-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_043797852.1.3990
Sequence length 711
Comment hypothetical protein [Arenimonas composti]; AA=GCF_000747175.1; RF=na; TAX=1121013; STAX=370776; NAME=Arenimonas composti TR7-09 = DSM 18010; strain=TR7-09; AL=Contig; RT=Major
Sequence
MRVALLARPGDARDQLRRALADAGAELVAEGDPAELDPGAVAGGQPGIVVVSLEPAIEEA
LERFDELLHADAIEVIYDDAEVTRQLDGWDLARWARHLAAKLTGATEVLPPAPEGQELHV
PVAAPADADDAPALELPEVDPAAIQPGAPPTPAQEMDAEKLEDYAAESLELSDWVPSNPS
LAAEPVEAPLAEANAAAGEEPSLELDLDLDLAGLEQALTAGADAAAPTLASALEASGIDV
PQQLDADEVPLHLEDTAAGAPASAEAPTAEVPLGLEDADAPLELEAADAPLDFDGGDAPL
DLEADDTPLDFDAGDVPLDFDPAGEAPLDLETSDEAPLDFASADEPMAFDGMEDTPLDFT
ADAAESEGPAADGDLDLDLDSGVDVPVAAGDDAPLPELEIGDGPVRFSTFTEDEQGAPAE
PAMDDDVAALAAQLEAFEANDTREMPREPDFANIALDPSPTPAAAAGPGRGAPAAPAAPA
AGGSLFDNLELVPMDADLGKVTAADANTPPAPSLAAVAEKRTVLNLAGENETRNVQAVSG
ALFVVAGLGGPDGVRQLLAALPPTLPVPVLLYQHLDTGKHERLVTQLSKASKLPLDLAVA
GKMAFPGRVAVLQPGIGISVRGEHVEFTEGSEGLAAVVAALPAADSAVLVLSGADPAVMP
AALALGAAGGLLLAQDPETCFDPVAPQAAIAAGGSTGAIAELARRIIERWS
Download sequence
Identical sequences A0A091BEK9
WP_043797852.1.19743 WP_043797852.1.3990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]