SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_044249296.1.12874 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_044249296.1.12874
Domain Number 1 Region: 22-133
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.96e-21
Family Heme-binding PAS domain 0.041
Further Details:      
 
Domain Number 2 Region: 165-257
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000667
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_044249296.1.12874
Sequence length 280
Comment diguanylate cyclase [Chondromyces apiculatus]; AA=GCF_000601485.1; RF=representative genome; TAX=1192034; STAX=51; NAME=Chondromyces apiculatus DSM 436; strain=DSM 436; AL=Contig; RT=Major
Sequence
MSALLSLLTSMDWSSSRALQQLIDAIPDPIFVKDLQHRWIACNAGLCKLLGQPYEKVIGH
SDPEYVTAEQAAEFWAHDDLVFRTGKPDDNEETHTIEGGQTRTIWTRKFPIKNAAGEVTG
LCAIITDITEIKQRLGEAERIERENAAQRLTIAAQAALLDRMAVPVLQVWQGILLVPLVG
EINARRAATALTNLLDAVVQHHAAFALLDLTGVLVFDGEVARYLARTVQATELLGCECVL
VGIGPEIARTLVSLNIHIEGVATRGTLQGGLAYAKERLSR
Download sequence
Identical sequences A0A017SWU4
WP_044249296.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]