SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_045183131.1.83425 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_045183131.1.83425
Domain Number 1 Region: 656-935,975-1060
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.3e-30
Family alpha-mannosidase, C-terminal domain 0.019
Further Details:      
 
Domain Number 2 Region: 272-555
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000439
Family 4-alpha-glucanotransferase, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_045183131.1.83425
Sequence length 1096
Comment glycoside hydrolase [Elizabethkingia miricola]; AA=GCF_000955665.1; RF=na; TAX=172045; STAX=172045; NAME=Elizabethkingia miricola; strain=BM10; AL=Complete Genome; RT=Major
Sequence
MTGNFIYAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRATDGAKTIEW
ETAKVPQKNSGPYVYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQHPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPINKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDASATPFILKDGKRLINLTTLHFGPEEKITAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNIQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKDGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKKWGDKPVWWLSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDSSISKFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDQLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLATLYSMLNP
RLYNSQSFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLDGNSLANQLEK
DLLQPLTNPGSKKIEVFNTSSWTRNGVATIPATAEGNSVQDATGNKIPLQKLENGTMVFI
AKNIPALGSAVYTIIKNKTLATKPFVVTNNSLSNGKITLTWDNKTGSITHFTDNDTTNYA
GSFKNQGLNSYWYVPGSDPNEAKSNTEVQTKILENGPVMVKVLLTADAPGANKLERIITL
YKDSDEALLENIIDKKTVRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDKGTLGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDTFNSVENEKYAAAFTQPLIAIPVNEKADIKGSL
FHVKNDKIVVTSITPQNDQSFIIRLYNPDEREQTTTFTWERLKPSKLIYNKTGKEIFIND
SVSLNSMDVIEIMVIP
Download sequence
Identical sequences WP_045183131.1.83425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]