SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_045583533.1.33993 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_045583533.1.33993
Domain Number 1 Region: 196-384
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.36e-62
Family Methylesterase CheB, C-terminal domain 0.0000187
Further Details:      
 
Domain Number 2 Region: 19-132
Classification Level Classification E-value
Superfamily CheY-like 1.21e-27
Family CheY-related 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_045583533.1.33993
Sequence length 387
Comment chemotaxis response regulator protein-glutamate methylesterase [Azospirillum thiophilum]; AA=GCF_001305595.1; RF=representative genome; TAX=528244; STAX=528244; NAME=Azospirillum thiophilum; strain=BV-S; AL=Complete Genome; RT=Major
Sequence
MSDSLGRGPLTPARPANPDPVRVMVVDDSAVIRGLLTRALEGDPDIRVVTSVGDGQMAVN
SLQRNSIDVIVLDIEMPVMDGLTAIPKLLAVAPQVKIIMASTLTLRGADVSIRCLSAGAA
DYIPKPTSTREIGGAEDFKRELVAKVKALGAAAKRAGSRSRGEIRPLTPALPLGLKRDVG
PIVTRPTPAGALAAKPDVIAIGSSTGGPQALFEVLSHLKAGVSQPILITQHMPATFTTIL
AEHISRQCGIDAREAKDGEPIVQNRCYIAPGDFHMLVVQRGGANVITLSKDPPENFCRPA
VDPMMRSILKAFGGRKILACILTGMGQDGLKGCTDVVNGGGTLIAQDEASSVVWGMPGAV
AQAGICNAILPLKEIGPHIRKLASRAA
Download sequence
Identical sequences A0A0F2KT22
WP_045583533.1.33993 WP_045583533.1.48275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]