SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_046146381.1.66551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_046146381.1.66551
Domain Number 1 Region: 535-940
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.49e-31
Family alpha-mannosidase, C-terminal domain 0.059
Further Details:      
 
Domain Number 2 Region: 121-319,348-428
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000139
Family alpha-mannosidase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_046146381.1.66551
Sequence length 964
Comment glycosyl hydrolase [Parabacteroides goldsteinii]; AA=GCF_000969835.1; RF=representative genome; TAX=927665; STAX=328812; NAME=Parabacteroides goldsteinii DSM 19448 = WAL 12034; strain=DSM 19448; AL=Scaffold; RT=Major
Sequence
MKKKIAYCLFASVLSSVIYADVVPSSVDYVVRPLYGYRADGTPGRIVTVKLKGKELKGEL
SVDVIAKGKTEKNHFALNAKDSTEVEILLPSTVPTGKKSEVTLVLRGADKVYKQKVSVTP
MRHWNVYLYNHAHVDIGYTNTHKNVEQLHKNNIIEGIKLAEETKSHPEGARYVWNPEIGW
PLERLWQSNPEMRDGVIDAIKKGQMCVDASYLNLNTSICTDEEMFHIFKFTREMQRLSGQ
PADVFQQFDIPGISWGLVPVMAQEGVRYIISWPNSDRAGNAHANMDGKPFWWLGPDGKSK
VLFFQPGSYANSGSMGKGGETGRPWFGQRDPEKVPKVIRTGYANVDFTRQLESMEKDNYP
YDFALFSWSLWDNNPLDADIPFAVKEWNEKYAYPKIRICGGHEIMSMIEDKYGDQLPVVS
GDYTEYWTDGLGTAAGLTAKNRNAKERLTQAETIWSMLADGGKAPREDFDEAWRYILLGS
EHTWCFENPTEPYFQDAIWKVKQSYFHEAEDRSIDMLDESLAPATDKSNGALGPKEGPSN
GGIAVFNTHSWPQSGVIRLSAKESLKGDKVVDQHGKEVLSQRLSTGELLFYVPEVPALSS
RHFRVVEGKCSLSGSCKIEGTTLENDCLTVHVDQATGNIVSLLKKGAEYNYIGEGANTFS
WLPANVDAPQADTVLSVSVVEEGPLAVELRVASKATGCRSVSRSVRLLAGQPWVEISNVV
DKLPLVEKDGIHFGFAFNLPDSKTRVDIPWGVMEVEKDQWPQGNRNWLAMQRWLDVSNAT
HGVTWCSLDAPLFEYGNRTANIALGWGDKGNWLKKLEPSSTVYSWVMNNHWHTNFPLTQE
GPVQFRYRLYPHEAYDVVEANRFGIEQSQPLVYVTADKDPQVEPLIAVDNRKVYSTIIKS
QENDRALIVRLRSLSDKEESVKLSFPKKVPVRISVCDREEIAGEQTDGNLVMAPYGQMTL
RLEY
Download sequence
Identical sequences WP_046146381.1.66551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]