SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_046147662.1.66551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_046147662.1.66551
Domain Number 1 Region: 509-964
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.2e-33
Family alpha-mannosidase, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 112-328
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.11e-21
Family alpha-mannosidase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_046147662.1.66551
Sequence length 965
Comment glycosyl hydrolase family 38 [Parabacteroides goldsteinii]; AA=GCF_000969835.1; RF=representative genome; TAX=927665; STAX=328812; NAME=Parabacteroides goldsteinii DSM 19448 = WAL 12034; strain=DSM 19448; AL=Scaffold; RT=Major
Sequence
MKTLKTLFLTGLALFVLSSFAWSASTAPPGIETHLFPALYKTAKGPVQKVRVTVKHEGAS
ANATITLGDQSRKVKLNDGPNPFFFEIPQVQSTVQLPLTVTVGKEQESTRVEVKPVRHWQ
MNMVQHTHTDIGYTRSQTEILAEHLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEY
LKCRPAEQIARLKKRVAEGRIELAAMYLNFDELPDEQTLAASLYPLKAFREAGMKAEVAM
QNDVNGIGWCFTEFFADAGVKYVNMGTHGHRALICFDIPTVFWWQSPSGKKVLTYRAEHY
NQGNFFGIHTDNFEQFEERVLNYLGEMEAKNYPYDIVAAQHSGYFTDNSPPSTKSCEMLM
KWNEKYEWPKLRTAVASEFIKDVETNYADKIQTIRGAWPDWWTDGFASGAREAAISRITH
SDIIANQAGLSFAGMLGAKLPAQIGNQIDDINKALLFYDEHTFGYSESVRNAYCKETWEQ
RSLKQSYAWEAYRHSGLLGEVTMGLLQSFVPKAEYPSVAVFNTLNWTYSGIAKVYIDHQI
LPREKAFEIVDAFGNIIPAQPAESRSDGTYWSLYVKDVPAFGYAQYYIKVKDEPRPAVQL
ADKLENAHVENPWYAIDFNTRKGTISKLFDKELNKELTTPNAEWELGEFIYEIIDSRHPM
EQYRAPQFLRRRPERIRFERYEKGAIWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIDI
VYRLRKKAITDPEAVYISFPFEVNQGKIFLDVPGGTIEAGVDQIPGSSNDWYTVQNFATA
RNSESQVVMGSPEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGELQ
WSYFINSSKDNSIGYATRFAWENRIPFLTRVLPAGAKGSKVVSPASVFNISSDNLLLVNM
KPVEGENAVMLQLREIAGKPAEFAVTSDKVNFTKVTVCDVVGDPVAGNATTDFVPWENKF
IKLSW
Download sequence
Identical sequences A0A0F5IR71
WP_046147662.1.66551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]