SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_047137346.1.47100 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_047137346.1.47100
Domain Number 1 Region: 266-437
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-18
Family Methylesterase CheB, C-terminal domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_047137346.1.47100
Sequence length 455
Comment hypothetical protein [Luteimonas sp. FCS-9]; AA=GCF_001014645.1; RF=na; TAX=1547516; STAX=1547516; NAME=Luteimonas sp. FCS-9; strain=FCS-9; AL=Contig; RT=Major
Sequence
MAERAAPATRVVVLARPGPACDRIVEGLVEAGADVLRPVDPLAADVRALDALAPEAIVVA
LEPAVEDALDALAPALERPGRIVVFEETALVLERSGWDAARWVRHLAVKLRLRHDALPPG
AGAMDVDAASIAPAPAAPRADGAAHAFDPVAAEYGEPPDGPPAPPAFVLALDDGPFAPVR
DPDDDANLPDAAGLASLDAPADADAGSTSAPPASDLDALPSFRGLAATPDADASLAPAKP
ATDLAELEQRIAGLSLADADSYGQGPQRGLVLVDGGLGGPDAVRQLLAALPEGFPRPVLV
RLRLDGGRYDRLVRQMARVTAAPVQLAEAGMTIAPGEVYFLPPDLLPLRAGGQLRFAADG
DLAALARAVPPDDSAWLLLSGADPALVELATGPAWHGALVAAQSEPGCYDPAATHALVAR
GGRSGAPAQIAAWLVERWMPDAAPGPAIEDGSWTL
Download sequence
Identical sequences A0A0H1AJZ4
WP_047137346.1.47100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]