SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_047202170.1.23142 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_047202170.1.23142
Domain Number 1 Region: 164-353
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.53e-60
Family Methylesterase CheB, C-terminal domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 3.42e-29
Family CheY-related 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_047202170.1.23142
Sequence length 357
Comment chemotaxis response regulator protein-glutamate methylesterase [Bacillus pumilus]; AA=GCF_001017485.1; RF=na; TAX=1408; STAX=1408; NAME=Bacillus pumilus; strain=15.1; AL=Contig; RT=Major
Sequence
MIRVLVVDDSAFMRKLISDFLSAEQEIEVVGTARNGEDALKRIKELNPDVVTLDVEMPVL
NGTEALKQILAEHDLAVIMVSSQTKQGKDLTIHCLELGAFDFVTKPSGSISLDLHKVRGQ
IVERVLAAGLSRKRTEEKVSPKPVIKPPSPVAAPRLQTVKGASLRKIISIGTSTGGPRAL
QRVVTKLPKDIEAPILIVQHMPAGFTASLAARLDHLSQITIKEAQDGDIAKNGVAYIAPG
GMNMSLHDQGGSLVIRLSPEDTESRHKPSVNYLFESISSIKGYEKIAVIMTGMGSDGTEG
VKKMVASGHTKVIAEKEESCVVFGMPKSVIKAGLAHETRHVDDIAHAIISSMKKERA
Download sequence
Identical sequences A0A0H1S0V4
WP_047202170.1.23142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]