SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_047484772.1.23370 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_047484772.1.23370
Domain Number 1 Region: 662-935,975-1086
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-31
Family alpha-mannosidase, C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 272-558
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000206
Family 4-alpha-glucanotransferase, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_047484772.1.23370
Sequence length 1096
Comment glycoside hydrolase [Chryseobacterium sp. OV705]; AA=GCF_000799645.1; RF=na; TAX=1500289; STAX=1500289; NAME=Chryseobacterium sp. OV705; strain=OV705; AL=Scaffold; RT=Major
Sequence
MTGNGIYAQKNVPYFGNIQATNGYSREISGENIDYFSAFPDHATRALLTRTTDGAKTIEW
ETAPVPQKNTGSYVYFNWLVSHSSGTSGGPRNFDLYINDQKALTLTTYPANQRPDWIAKA
ADSTAFVFHQTKMDGLKDSYGIAYLRVPVSKVTPGKPLRLKIVGQAQNSRDWLMTYKFTF
QEKIDAQSTPFLLKDGKRLLTLTTLHFGPEQKITAKIDNKDTFSFTMPDGIKTFDIPVSL
SSKGGNIELVVTSGKKELLRKTIQAGAVVPRTLYFVHHSHTDVGYSHLQAEVEKIHTQNI
YDALKMIEETKNLPEEARFKWNVEALWDVENFMRKATPEDKKAFAKAVKEGGIGLSAVYG
NILTGLSQPEELFHYTEYAQKLEKEFGFTINSAMMSDVPGFAWSLVPALASSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKKWGDQPVWWQSPSGKQKILFWAAGRGYSSWHGVHPGAVFE
NGQKKIAEYLEDLTHANYPYDMVQWRYNIVADNGPIDPSISKFVDEWNKKYESPKIVLST
NEKMFEIFEKKYGDQIPVVKGDISPHWEDGAMSTAKEEGINRNSSLKLQQLTTLYAMLNP
RQYSGQHFYEAWRNVILFHEHTWGAFNSITAPDLPFVKDQWQVKKQFSLDGSSLADKLEK
ELLQPITDPASKTIVVFNTSSWVRSGTVSVPEANLGNAVQDASGNKIPLQKLQDGTMAFI
AKNIPPLGSAVYTIIKTKVPAADPFTITTNSISNGKVTVTWDSKTGSITHFTDNSTINYA
GSFNNQGLNSYWYVPGSDPKEAVSNSDIQVKVLEKGPAMARVSLVSEAPGAKKLERIITL
WSDSDEISLENILDKKSVRSKESVHFGFPFNTDFKNITVDAGYGTMKYLTDQLPGSNMDY
WYSRRWVDASFGQKGMQWMMLETPLIEAAEMIDERMVIDNSHKKWKEQGTPYTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHSAFNAVENEKYAAAFTQPLIAIPMKEKSPLTGSL
FLMNNDKVVVTSITPQEDQSFMIRLYNPDEKEQTTAFLWKQLQPSKLIDLTTGKTMSPNE
KLSLSGMDVVEIKVIP
Download sequence
Identical sequences WP_047484772.1.23370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]