SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_048025344.1.77508 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048025344.1.77508
Domain Number 1 Region: 747-997
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.83e-33
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 
Domain Number 2 Region: 33-215
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.06e-18
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.078
Further Details:      
 
Domain Number 3 Region: 461-649
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.71e-17
Family Pyruvate oxidase and decarboxylase PP module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_048025344.1.77508
Sequence length 1196
Comment MULTISPECIES: indolepyruvate ferredoxin oxidoreductase [Burkholderia]; AA=GCF_001718395.1; RF=na; TAX=292; STAX=292; NAME=Burkholderia cepacia; strain=INT3-BP177; AL=Complete Genome; RT=Major
Sequence
MNAPLDADQRASLEAALKSVTLDDKYTLERGRAYMSGIQALVRLPMLQQERDRAAGLNTA
GFISGYRGSPLGGLDLSLWKAKQHLAAHQIVFQPGLNEDLAATAVWGSQQVNLYPGAKHD
GVFGMWYGKGPGVDRTGDVFKHANSAGSSQHGGVLVLAGDDHAAKSSTLAHQSEHIFKAC
GLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVESSASVDIDPHRTEIVLPTD
FILPEGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLDRIEIDSPNARFGIMTGGKA
YLDVRQALTDLGLDDETCARIGIRLYKVGCVWPLEAQGAQAFARGLDEILVVEEKRQILE
YAIKEELYNWPDGQRPRVFGKFDEKDGAGGEWSVPMGNWLLPAHYELSPAIIAKAIATRL
EKFELPSDVRARIAARLAVINAKEMALAKPHVQTERKPWFCSGCPHNTSTNVPEGSRAIA
GIGCHYMTVWMDRNTSTFSQMGGEGVPWIGQAPFTDEKHVFANLGDGTYFHSGLLAVRAA
ISSKANITYKILYNDAVAMTGGQPVDGVLTVPQITHQLASEGAKKIVIVTDEPEKYDSQK
ALLAPGVPIHHRDQLDDVQRELREIEGTTILIYDQTCATEKRRRRKRGTYPDPAKRVVIN
DAVCEGCGDCSVQSNCLSVEPLETEFGTKRQINQSSCNKDFSCVKGFCPSFVTVEGGQLK
KPKAVSVDGNALPPIPEPTLPDIDRAYGVLVTGVGGTGVVTIGALLGMAAHLENKGVTVL
DVTGLAQKGGAVMSHVQISHAPTDIHATRIAMGEADLVIGCDAIVTAGDECTSRMRHDTT
RVVVNSAQTPTAEFIKNPNWAFPGLSAENDIRAAAGEAVDFIDANRFAVALLGDAIYTNP
FVLGYAWQKGWLPLTLASLERAIELNAVSVEKNRAAFDWGRRAAYDLASVKQAAAGDARP
AQGATVIALHTKKAVDALIAKRVEFLTAYQNAAYAARYAAFVDKVRAAERALADGDTVQE
QLTEAVARNLFKLMAYKDEYEVARLQSDPAFLARLSAQFEGDWKLKFHLAPPLFAKTDAH
GHLVKKAYGPWMMTAFRWLAKAKFLRGTGLDPFGRTEERRSERALIGEYEALIDEVLARL
NAANRPLALELAALPDGIRGYGHVKENNLRAVRQKWSTLLAKWRAPAGGQSHQQVA
Download sequence
Identical sequences A0A0J5UC78 A0A0J6MBJ0 A0A119F0N9
WP_048025344.1.12 WP_048025344.1.27092 WP_048025344.1.30330 WP_048025344.1.47938 WP_048025344.1.58201 WP_048025344.1.60915 WP_048025344.1.66976 WP_048025344.1.77508 WP_048025344.1.79362 WP_048025344.1.84302 WP_048025344.1.86351 WP_048025344.1.97923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]