SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_048048279.1.76508 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048048279.1.76508
Domain Number 1 Region: 10-199
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_048048279.1.76508
Sequence length 200
Comment indolepyruvate oxidoreductase [Methanosarcina mazei]; AA=GCF_000979345.1; RF=na; TAX=2209; STAX=2209; NAME=Methanosarcina mazei; strain=2.F.A.2.4; AL=Scaffold; RT=Major
Sequence
MSERAGEKKLDLLITGVGGQGAILASDIIGKAAVISGIPIRAAETHGMAQRGGSVVNHIR
LGSDLGSMIPKKGADIMLALEPMEAVRYLDFLKDGGVIIVNTQPIIPVTVTSGLSKYPEV
QEILDALSEKYVVKAFNADELAHEAGSRLAMNVAMVGAVSGYLPISKEVLLESVKALVPK
KTIEINIRAFEMGRQKVEES
Download sequence
Identical sequences A0A0F8B9C1
WP_048048279.1.29761 WP_048048279.1.76508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]