SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_048174000.1.43275 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048174000.1.43275
Domain Number 1 Region: 601-964
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.58e-50
Family Quinoprotein alcohol dehydrogenase-like 0.0065
Further Details:      
 
Domain Number 2 Region: 12-328
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.04e-30
Family Pectin methylesterase 0.031
Further Details:      
 
Domain Number 3 Region: 968-1049
Classification Level Classification E-value
Superfamily PKD domain 1.01e-29
Family PKD domain 0.00026
Further Details:      
 
Domain Number 4 Region: 335-421
Classification Level Classification E-value
Superfamily PKD domain 2.22e-25
Family PKD domain 0.00043
Further Details:      
 
Domain Number 5 Region: 426-510
Classification Level Classification E-value
Superfamily PKD domain 9.42e-24
Family PKD domain 0.00043
Further Details:      
 
Domain Number 6 Region: 512-597
Classification Level Classification E-value
Superfamily PKD domain 1.83e-21
Family PKD domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_048174000.1.43275
Sequence length 1262
Comment cell surface protein [Methanosarcina siciliae]; AA=GCF_000970085.1; RF=representative genome; TAX=1434120; STAX=38027; NAME=Methanosarcina siciliae T4/M; strain=T4/M; AL=Complete Genome; RT=Major
Sequence
MKKMHYVCMVALLSTMMLAVAPASATTWDVSTVSELQNAAANAGEGDTIFVHNGNYTLTS
TLYLYKSNITFTGESKEGVVLLRDNDFITIGSNDGPAPGCIVENMTLLGDITSTSGVFGI
SVRSPDCTLRNLILRDIRDCAVISSNSEDCSSLIISNCTFDNSGTENFAISILATNSIIE
NNVIKNNQYAYGPLCVQAQNVTVSNNLFMNNPYAFYLVYADNSLVSGNNMVSSGNILIYD
PGENIVWQLNNFNESIVSNEWAGPLPSATYWNSTEPVEYTYNGATYNGYPGNYWGAAYTG
TDADGDGIGDTPYEVPDSLGTDYSPLISPKENYEILEPPVVNFNAAPLSGNVPLAVRFTD
QSTGSGISSWAWDFDGDGNVDSTEQNPSHTYNSTGAYTVSLSVTGQLGSDSKTKVDYITV
REPAEPPIADFSADPLSGPVPLEVRFTDLSTGEGIDSWSWDFDSDGTVDSTEQNPTFTYS
EIGNYTVTLTVTGTGGNDSKVKTYYIVSEEAEPAFPTAGFSASSRDGAVPFTVKFADNSE
NTTVWAWDFDNDGNVDSTEQNPLYTYYTEGDYTVKLTASNGNGSDVLEIPDMITVAPEKP
APPDDSWYQFHGKVDHLGYSENGPKTNRTEWVSEGITDVIGSSSPIVAEGKIFVICGGAG
MEEETTGIVQLVALNESTGDITWNVSIPETVYGSWASPAYDDGMVFTATGPELGCYDAET
GEKIWCFNDTVGTLGAVNGGPAIADGMVIFSDWDGHHYYCLDEYTGYLLWSFVVVGDAQS
VPAYADGKFYLTGWTYTQGYAYCVDATTGEQLWNINVERSFCGSPAYKDGVLYLTTYNFS
GDGDLFALNATDGSIIWQQTVQRTDSTPALAYGNVYVSGGCTGFSDKETYCFNATTGEPV
WSIPSIGDWTWSVAVADGLAYVGGYALDAFTGDVVWNSPYGGGTPALSDGMLFSIGSNKK
VYAFKDSLSSPVANFSADITSGNAPLTVNFTDQSAGSPTSWLWDLGDGENSTEQNPSHTY
TSAGNYTVNLTVENATGMDFELKSDYIEVSEVSGSTVTLYFDPESFSVSENESTEINLVA
SNFPAGLSGYNLTVAIDDPDVAEIVDIEYPSWALITENSTLPGTSIYLKTVDGEDTVQAG
AADAVLATLTVSGKEKGSANLSIEVDRLDDDSGNVIEPALFAGKIEVTLLFPLPDQEYAP
KDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVDMFA
MI
Download sequence
Identical sequences A0A0E3PAJ5
WP_048174000.1.43275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]