SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_048185006.1.11460 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048185006.1.11460
Domain Number 1 Region: 682-972
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.4e-45
Family Quinoprotein alcohol dehydrogenase-like 0.001
Further Details:      
 
Domain Number 2 Region: 976-1056
Classification Level Classification E-value
Superfamily PKD domain 1.07e-31
Family PKD domain 0.0003
Further Details:      
 
Domain Number 3 Region: 12-328
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-31
Family Pectin methylesterase 0.037
Further Details:      
 
Domain Number 4 Region: 335-420
Classification Level Classification E-value
Superfamily PKD domain 1.31e-24
Family PKD domain 0.0005
Further Details:      
 
Domain Number 5 Region: 425-508
Classification Level Classification E-value
Superfamily PKD domain 8.11e-23
Family PKD domain 0.00037
Further Details:      
 
Domain Number 6 Region: 512-597
Classification Level Classification E-value
Superfamily PKD domain 8.24e-23
Family PKD domain 0.00029
Further Details:      
 
Domain Number 7 Region: 601-709
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000463
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_048185006.1.11460
Sequence length 1269
Comment cell surface protein [Methanosarcina siciliae]; AA=GCF_000970145.1; RF=na; TAX=1434118; STAX=38027; NAME=Methanosarcina siciliae C2J; strain=C2J; AL=Complete Genome; RT=Major
Sequence
MKKIHYVCMVALLSTMMLAVAPASATTWDVSTVSELQNAAANAGEGDTIFVHNGNYTLTS
TLYLYKSNITFTGESKEGVVLLRDNDFITIGSNDGPAPGCVVENMTLLGDITSTSGVFGI
SVRSPDCTLRNLILRDIRDCAVISSNSEDCSGLIISNCTFDNSGTENFAISILATNSIIE
NNVIKNNQYAYGPLCVQAQNVTVSNNLFMNNPYAFYLYQADNSLVSGNNMVSSGNILIYD
PGENIVWQLNNFSESIVSNEWAGPLPSATYWNSTEPVEYTYNGSTYNGYPGNYWGAAYTG
TDADGDGIGDTPYEVPDSLGTDYSPLISPKENYEILEPPVANFNAVPLSGNVPLAVRFTD
QSTGSGISGRAWDFDGDGNVDSTEQNPSHTYNSTGAYTVSLTVTGQLGSDSKTKADYINV
KEPAEPPIADFSAEPLSGPVPLEVRFTDLSTGEGIDSWSWDFDSDGTVDSTEQNPIFTYS
ETGNYTVTLNVTGTGGSDSKVKADYIVSEEAEPAFPTAGFSASARDGAVPFTVKFTDSSE
NTIDWAWDFDGDGNVDSTEQNPLYTYYTEGNYTVKLTASNGNGSDVLEIPDMIKVAPERP
APPEDSWYQFHGKVNHLGYSENGPKTNRTEWISEGVTDAIGSSSPVVAEGKVFVICGGAG
MGEETTGVVQLVALNESTGDITWNVSIPETVYGSWASPAYDDGMVFTATGPELGCYNAET
GEKIWCFNDTVGTLGAVNGGPAIADGMVIFSDWDGHHYYCLDEYTGYLLWSFVVVGDAQS
VPAYADGKFYLTGWTYTQGYAYCVDATTGEQLWNINVERSFCGSPAYKDGVLYLTTYNFY
GDGDLFALNATDGSIIWQQTVQRTDSTPALAYGNVYVSGGCSGFSNVQTYCFNATTGTPV
WSTPSKTGDDGGIGDWTWSVAVADGLAYVGGYALDAFTGDVIWNSPYGGGTPALSDGMLF
SIGSNKKIYAFKDSLSSPVANFTATPTAGDAPLTVNFTDQSTGTPTSWLWDFGDGANSTE
QNPSHTYTSAGNYTVNLTVENATGMDFELKSDYIEVSEVSGSTVTLYFDPESFSVSENES
TEINLVASNFPAGLSGYNLTVAIDDPAVAEIVDIEYPSWALITENSTLPGTSIYLKAVDG
EDTVQAGAADAVLATLTVSGKEKGSANLSIEVDRLDDDSGNVIEPALFAGKIEVTLLSPL
PDQEYAPKDLDGDGLYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYLDFNGNGRIDFD
DVVDMFAMI
Download sequence
Identical sequences A0A0E3PT39
WP_048185006.1.11460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]