SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_048186217.1.11460 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048186217.1.11460
Domain Number 1 Region: 813-1060
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.38e-38
Family Quinoprotein alcohol dehydrogenase-like 0.0047
Further Details:      
 
Domain Number 2 Region: 120-504
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.54e-32
Family Quinoprotein alcohol dehydrogenase-like 0.0068
Further Details:      
 
Domain Number 3 Region: 1060-1141
Classification Level Classification E-value
Superfamily PKD domain 9.03e-26
Family PKD domain 0.00027
Further Details:      
 
Domain Number 4 Region: 23-105
Classification Level Classification E-value
Superfamily PKD domain 4.71e-22
Family PKD domain 0.00028
Further Details:      
 
Domain Number 5 Region: 527-607
Classification Level Classification E-value
Superfamily PKD domain 4.97e-22
Family PKD domain 0.00058
Further Details:      
 
Domain Number 6 Region: 609-694
Classification Level Classification E-value
Superfamily PKD domain 1.96e-20
Family PKD domain 0.00059
Further Details:      
 
Domain Number 7 Region: 698-852
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000314
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_048186217.1.11460
Sequence length 1270
Comment cell surface protein [Methanosarcina siciliae]; AA=GCF_000970145.1; RF=na; TAX=1434118; STAX=38027; NAME=Methanosarcina siciliae C2J; strain=C2J; AL=Complete Genome; RT=Major
Sequence
MAIIPASATTSDWLLGEGSSGGVTPVANFSADVTSGTAPLTVNFTDESTGAESWAWDLDG
NGIVDSREQNPVHTYTTAGEYSVNLTVTSFNSIDSEIKTGYITVMSDGSSGGEGGETPVV
VAPVPDSSDTAMFKNNLYHTGVTSQAGPIDEPELVWSAHTGYMNTDPLVLDDFLVSVCSR
NISVHNFTTGEYIWNTVTSGENLGPACYGNGTIFYPESSKGKFSAYDIRNGELLWNITGL
GGSYSQLNTPVVYEDHRIYFGTCYGDPSAYYCYYDNGTQCWSYEGGGYYWAGAAVIGDCL
VFGGEDMNLTSLNKNTGELVDEINVSAVFSIPNSGSQIQSSVSYDENSSRCYFTTTSGHC
CVIGFDKSTGKFVRTDKASHSIGPSTSTPAIYNGRLYVGVGKMFKSGGEPCLFCLNASDL
SEIWKYTANGIIQSSPTVSTYYENSTGDIYIYFTTNVKNGTVYCLRDNANNTDAIEVWHW
TPPESMQQYVLGGAVIKQGYLFFGNNEWKGAAGCTFALKRSNSGSVVADFSAENTFGKVP
LNVSFTDESTGDGINEWLWDFGDNTTSNETNPYHIYEKNGLYTVNLTVTGSGGSDTSART
GLVNVTDQITPIADFSYSVSGTQSPVSVEFTDTSDNTNSATAWYWDFGDNTTSNLQNPTH
QYAEEGTYSVTLTVSSHQENNTVKKSGIIVVEPWNVPEWATNDSWTQFQKNEQHNGFSEG
SAPSTATRLWVSDDIGAVRSSSVSVSEGRIFVNCNDNDTGVSVIRSLNQQTGAFLADHGK
ADGGGFYGSWSSPVYDGGKVWCGLNNYPEGTTYNSVNGGTMVADGKVFSSNWNGNQYFCF
EESTGEELWNFSAPVSSYAQSCPAYKDGKVYVLYWQGFSGDGENLVYCLNADTGDEIWKH
ANISSNPCGSPMITDDAVYFTTYNPDGESAQLYALNITDGSVLWSNTSITGTDSTPAYAY
GNIYVSSGYSRYITYCFNATTGEPVWETDPEDNIGFWTFSPAVADGKVYVGTGGSGIVCL
DASTGELIWQDKGGGSTPAIVDGVVYSIGKDGKVYAYSSNQSVADFTANPISGEAPLTVN
FTDQSNCAESWSWDFDNDGNVDSTEQNPVHTYTAAGNYTVNLTVTNTEGSESEVKTDYIK
VEEASSGSQNGSSSVSLNVTIVPVISLEVSPSSLDFGELYPGKTSELQYITLKNIGNCDV
NVTAIVCDSSAGDQLFSQGLLLDSQLWNNYWKVVGGNSQENTSVALKVPADYAGSGNKKG
TITFWAEAAE
Download sequence
Identical sequences WP_048186217.1.11460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]