SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_048317986.1.82567 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048317986.1.82567
Domain Number 1 Region: 509-965
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.04e-34
Family alpha-mannosidase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 112-328
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.61e-21
Family alpha-mannosidase 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_048317986.1.82567
Sequence length 965
Comment glycosyl hydrolase family 38 [Parabacteroides goldsteinii]; AA=GCF_001039445.1; RF=na; TAX=328812; STAX=328812; NAME=Parabacteroides goldsteinii; strain=910340; AL=Contig; RT=Major
Sequence
MKTLKTLFLTGLALFAMSSFAWSASTAPPGIETHLFPALYKTAKGPVQKVRVTVKHEGAS
ANATITLGDQSRKVKLNDGPNPFFFEIPQVQSTMQLPLTVTVGKEQESARVEVKPVRHWQ
MNMVQHTHTDIGYTRSQTEILAEHLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEY
LKCRPAEQIARLKKRVAEGRIELAAMYLNFDELPDEQTLAASLYPLKAFREAGMKAEVAM
QNDVNGIGWCFTEFFADAGVKYVNMGTHGHRALICFDIPTVFWWQSPSGKKVLTYRAEHY
NQGNFFGIHTDNFEQFEERVLNYLGEMEAKNYPYDIVAAQHSGYFTDNSPPSTKSCEMLM
KWNEKYEWPKLRTAVASEFIKDVETNYADKIQTIRGAWPDWWTDGFASGAREAAISRITH
SDIIANQAGLSFAGMLGAKLPGQIGNQIDDINKALLFYDEHTFGYSESVRNAYCKETWEQ
RSLKQSYAWEAYRHSGLLGEVTMGLLQSFVPKAEYPSVAVFNTLNWTYSGIAKVYIDHQI
LPREKAFEIVDASGNIIPAQPAESRSDGTYWSLYVKDVPAFGYAQYYIKVKDEPRPAVQL
ADKLENAHVENPWYAIDFNTRKGTISKLFDKELNKELTTPNAEWELGEFIYEIIDSRHPM
EQYRAPQFLRRRPERIRFERYEKGAIWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIDI
VYRLRKKAITDPEAVYISFPFEVNQGKIFLDVPGGTIEAGVDQIPGSSNDWYTVQNFATA
RNSESQVVMGSPEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGELQ
WSYFINSSKDNSIGYATRFAWENRIPFLTRVLPAGAKGSKVVSPASVFNISSDNLLLVNM
KPVEGENAVMLQLREIAGKPAEFAVTSDKVNFTKVTVCDVVGDPIAGNATTDFVPWENKF
IKLSW
Download sequence
Identical sequences A0A0J6F7U4
WP_048317986.1.82567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]