SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_048507159.1.69240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048507159.1.69240
Domain Number 1 Region: 670-948,988-1072
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.35e-26
Family alpha-mannosidase, C-terminal domain 0.021
Further Details:      
 
Domain Number 2 Region: 283-581
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000272
Family 4-alpha-glucanotransferase, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_048507159.1.69240
Sequence length 1109
Comment glycoside hydrolase [Chryseobacterium angstadtii]; AA=GCF_001045465.1; RF=representative genome; TAX=558151; STAX=558151; NAME=Chryseobacterium angstadtii; strain=KM; AL=Contig; RT=Major
Sequence
MQKKYFTLFVFILVSGNFFYGQKKVPFFGHIEAVNGYAREISGENIGYFSAFPDYANQAL
LTRATDGAKIIEWETEAVPGKIKGPYIYFSWLASHSSGSSGGIRHFDLSINDKKVLTLTT
YPGNKNPDWIAKAADSTAFVFHQTKTDGLKDSYGIAYLRIPLNKVTPGKPLKLKMTGKAE
NSRDWFMTYKFTFQEKMDAEMTPFILKDGRRMITLTSLHFGKEQKITAKINNKETFSFNM
EDGIKSFEIPVSVSEKEKSVLITVTADEKELYRKDLAVETVVPRTLYFIHHSHTDVGYSH
LQAEVAKIHTQNIYDALKMIEETRSLPEEARFKWNVEALWDVENFMQKASPKEIQSFVKA
VKEGSIGLSAMYANILTGLSQPEELFHYTEYAQKLEKEYGLSIKSAMMSDVPGFAWSLVP
ALTSSGVKYFSSGPNYLGKSNPYLGDRVGNFVKSWGDRPVWWESPSGESKILFWTGGRGY
SSWHGIHPGEVFENGKKKIAEYLNDLTKSQYPYDIVQWRYNIVADNGPIDTSVSKFIDEW
NKKYASPKIILSTNEKMFEAFEKKYGNQIPVVKGDISPYWEDGAMSTAKEEGVNRNSSLK
LQQLTTLYSILNPELYDRQKFYEAWKNVILFHEHTWGAFNSITAPDLPFVTDQWKVKKQF
SSDGNILANQLEEDLLKPITSPASKTIAVFNTSSWKRSGTVIMKNNLDGNGLEDAKGNKI
PVQKLTDGTVAFIAENVPALGYTSYKVIKEEVKGQNPFSVSANEVSNGKVAVAWDTKTGS
IIKIKDKSEFNHAGSFNKQGLNSYWYVPGLNPQDALSNTDTKVKILENGPVAVKISLLSE
APGAKSLERILTLFADSDEVFLENIVDKKPVRTKESVHFGFPFNSGFKDITVDAGYGVMK
YLTDQLPGSNMDYWYSRRWVDASSGKKGIQWMMLETPLIEASEMIDERMIIDNSHKKWKD
KGNPGTTNWFSYAMNNYWHTNYKADQEGPVHYHYVLRPHDAFNSVENEKAAAQFTQPLTA
VPVKDKWSSGESLFQMSNDRIVVTSVTPEKERSFVIRLYNPDEKEQSSTLLWEKLKPKKL
IILKTGKVFSTNEKITLAGMDVVEIKVMP
Download sequence
Identical sequences A0A0J7IGJ6
WP_048507159.1.69240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]