SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_048927818.1.40665 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048927818.1.40665
Domain Number 1 Region: 506-961
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.22e-34
Family alpha-mannosidase, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 112-324
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.23e-21
Family alpha-mannosidase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_048927818.1.40665
Sequence length 962
Comment glycosyl hydrolase family 38 [Parabacteroides sp. D26]; AA=GCF_001078555.1; RF=na; TAX=658662; STAX=658662; NAME=Parabacteroides sp. D26; strain=D26; AL=Scaffold; RT=Major
Sequence
MKKRTYLSAGLALLIGTLSVHASPGLSDIKSRVLPAVYKSKNGLTQKVEISVKHEGEPST
VTIRLGEQSHKEKLVSGDNVFRIEIPEVSTTRQLPLTLTSGKEKEESTVTVKPVRHWQMN
MVQHTHTDIGYTRSQMEILAEHLRYIDYALDYCDATDNYPDFAKFRWTCEIAWAVSEYLK
CRPAEQIARLKQRVKEGRIELATMYLNFDELPDEQTLAASLYPIKQFRENGMRAEVAMQD
DVNGIGWCFSEYFADAGVKYVNMGTHGHRALICFDKPTVFWWESPSGKKVLTYRAEHYNQ
GNFFGIHTDDFEQFEERVLAYLDQMEAKNYPYDILVAQHSGYFTDNAPPSTKSCEMLQKW
NEKYEWPKLRTAVASEFFKTVESQYADRIETVRGAWPDWWTDGFASGAREAAISRVTHSD
IIANQAGLSFAKMLGAQLPTDINDRIYDINKALLFYDEHTFGHSESVRNAYGLETWEQRS
LKQSYAWEAYRHSGLLGEATMGILQSFVPKSDVPSIAVFNTLNWSYSGIAKAYVDHQILP
KDKAFEIVDAAGNVIPAQAGESRSDGTYWNFYVKDVPALGYAQYYIKVKDAPRPEIQGAT
ELKETHVENPWYAIDFNTRKGTIRKLYDKDLNKQLVTPDAEWEMGEFIYEIIDSRHPMEQ
YRAPQFLRRRPEKMRFEKYEKGDVWDTYRFRGETVAGREPNNLMVEFRVFNVTKKIEVVY
RLRKKAVTDPEAVYIAFPFEVEGGKIHLDVPGGSIEAGVDQIPGSSNDWYTVQNFATARN
GESQVVMGSQEIPLMQFGAINTGRYKAGAVPQSTNMYSWPMNNYWVTNFNADQMGEMQWS
YFINSSKDNTIEYATKFAWENRIPFLTRVLPAGDKKVEPLQSASIFKIVPENLLLVNMRP
VEGENAVMLQLREIGGKPATFSVASDKINFVKTTVCDVVGDPVSGNPLSFAPWENKFIKL
SW
Download sequence
Identical sequences A0A0J9DH53
WP_048927818.1.40665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]