SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_049556581.1.52417 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_049556581.1.52417
Domain Number 1 Region: 108-303
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.5e-19
Family 4-alpha-glucanotransferase, N-terminal domain 0.055
Further Details:      
 
Domain Number 2 Region: 536-988
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.2e-18
Family alpha-mannosidase, C-terminal domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_049556581.1.52417
Sequence length 1001
Comment hypothetical protein [Nonomuraea sp. SBT364]; AA=GCF_001083785.1; RF=na; TAX=1580530; STAX=1580530; NAME=Nonomuraea sp. SBT364; strain=SBT364; AL=Scaffold; RT=Major
Sequence
MTSRLLQRSLGSPDYDGIRQALRDDTSTPVISVRGLEVRVAVLPLFTHDGRQAVRVSSTR
PLTHVLVDADSASGADVTLLVPEVTEPRAFTLECRDEAGVVGSARITVEPQRKWNVFVVH
HSHLDIGYTDPQGTVLRHHLDYLDAAVRLAGETASWPDDAKFRWSVESSMPALKWLDARP
AEQVEKFAALAREGIIEVTALPFQLHTEACSTEELYRQLRFTGELRHAHGIPARSAMHTD
VPGAVVGLIDALNAAGVRYLAAAHNWAGRSVPYLHGGDKLTRPFRWRAPSGNELLVWFTD
TPHGMAYMEGNTVGLTDSYELADDLLPRYLAALASRGYPYGPGTFGWQGPDAPREPYELD
VLHLRVQGAHADNAGPSIVPASIARRWNEQWAYPRLRSAVNSDFFDHVAEHYHDRLAVHE
GDWTDWWADGLGSGARPLGYVRRAQSALRAAETLHTLAGIDAGEPIGLAYDKVALFNEHT
WGAANPWEDAEEAGDSGGLQWTRKSSGAYDAQDDAADLLQAGVRRFSAALSGENVSGEAA
AAFAVFNPGTVTRTDVVRTFLPRDVVPVDVPIALVDARTGETVPHHEEYVDPVDWPTRPI
GRHIHAVVPDIPGFGYVRLDVVRGEEQAPEPVELDLGGVIENEFYRVTYDVREGYISSVF
DKLAGRELVNQDAAAGFGQYVYDRYATAPHFNHLSGHVGAHDRTLLGDRAIAGNATIVRA
ERTAVGEKLVVELRGKGVDWLRTTVELHRGVARLDLTYQLAKQGTPAKEAVFLAFPLATG
QATAWELTGGVGGPDVPRVPGSAEYMLPIRHWIAFEDKELTVAWATLEAPLVQLGTIHMP
YAPFPPTLDQEDGTVYSWALNNIWDTNFPAQQQGETTFRYAVRSEAGAPGRRLGALTAAG
LTDPLVGALLTGPAGEPSRTYVSVDHPDVLVTSLGRQDEATLVRLQSLAAEPVEVTVTLP
GLLGAGVSAGLDREIRPVEVSGESVKVRLPACGVAVVWGDL
Download sequence
Identical sequences WP_049556581.1.52417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]