SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_049703133.1.610 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_049703133.1.610
Domain Number 1 Region: 208-553
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.62e-23
Family Quinoprotein alcohol dehydrogenase-like 0.0039
Further Details:      
 
Domain Number 2 Region: 121-206
Classification Level Classification E-value
Superfamily PKD domain 3.66e-21
Family PKD domain 0.0024
Further Details:      
 
Domain Number 3 Region: 33-119
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000144
Family PKD domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_049703133.1.610
Sequence length 587
Comment hypothetical protein [Bacteroides sp. 3_1_13]; AA=GCF_001185845.1; RF=na; TAX=457389; STAX=457389; NAME=Bacteroides sp. 3_1_13; strain=3_1_13; AL=Scaffold; RT=Major
Sequence
MNKVMMKKYIFLMLVAVCLFSCKDDEKVRQTKSPEVAFTTDKEEYTLGDIVYLTDESVET
EGQIAEYFWHFGFDGEGNRATTKDASVLYKKAGTYVVKLTVTDEFGGYATASHTVVIRPT
NRPPMADFSYNPAICKVNEKVKFTDKSTDEDGEVVAYEWDFGNGQTSQEKDPEVTFTTAG
FVTVKLTATDDRGATNTKQATLYVRNTSVSGLQILWTKTFETSSSLRSISPAVGDNGDVY
VSSNALHLYAYSPSGDQKWAFDLSKDGGAGDQGSSPMVDADGTIYIGSSTTNKNISSSLY
AIHPDGTQKWRYEIGIGTNIPYISPALARDGNILIGNRGTDGSVHMVDRSSGRQLWRRKS
PNGGANGGISVGQNGVVYSALSGANGFARTTEDGVNLSPNLGKGNTAAAVYPAIDAQGNV
YVAFSEGVIAAYDDQGNELWRYPATGTIGKIDQGGPAIGADGTIYVGTKNPNAQVIALTK
GGTKKWSYASSAEIGTTPAVDSEGNIHICDDGGNYIVLNADGTEKYRQQLGTKIWSSPVI
ADYGIVYVTYEENGACKLVAIDCGIEGPANSPWAQRGQNAKRNALQK
Download sequence
Identical sequences WP_049703133.1.610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]