SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_049774353.1.77901 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_049774353.1.77901
Domain Number 1 Region: 124-437
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.94e-66
Family Carboxypeptidase T 0.028
Further Details:      
 
Domain Number 2 Region: 627-738
Classification Level Classification E-value
Superfamily PKD domain 1.09e-18
Family PKD domain 0.0016
Further Details:      
 
Domain Number 3 Region: 568-650
Classification Level Classification E-value
Superfamily PKD domain 0.000000144
Family PKD domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_049774353.1.77901
Sequence length 768
Comment GlyGly-CTERM sorting domain-containing protein [Shewanella woodyi]; AA=GCF_000019525.1; RF=na; TAX=392500; STAX=60961; NAME=Shewanella woodyi ATCC 51908; strain=ATCC 51908; AL=Complete Genome; RT=Major
Sequence
MKTAESIARLTKGITLSRLTKSLIISGLIFSSLAQSQAQAIDDSQQTYKVTFPDEQTFLK
ANISLHNEKIKTDPTQRAIWVPLSSDELSRLKPFATSMAKVDDPASLYPQKIASQSNLLS
GIPGYSCYPTVEETQTDIEQLVSQNPNFATIEDIGDSWQKQAGNGGYDLNLLKLTNSQVT
GDKPKLFIHAAMHAREYATSPLVLQFAKDLLSERDTDADSQWLLDRHEIHLLLHMNPDGR
KKAETGLSWRKNANQNYCGSNPNAIGTDLNRNFSWGWNTVEQGSSGNECSNIFRGPSAGS
EPETQAVEAYVRALFGDHRGPNRTDAAPDTTQGLHIDVHSYSELVLWPWGGTNALAPNGA
AMRTLGRKLARFNGYMPMQSVGLYPTDGTSDNLSYGELGIPHMTFELGTDFFQSCSSYND
KVLPDNLKALKYAAKIVEAPYLIPSGPDITEISSVGQPLNAIAQNYRVTLKVTASDDRFS
RRGGTEATQDIAEIALYIDDAPWDGGQATLLTATDGSFDEKTEQGELQLNANDLSLGQHT
LYLKAKDTSGQWGALSAQFIQVIAPQANQAPQANFSFQCDEFTCQFDASSSADPEGDSLS
YAWQLGTGTSREAQPSYQFSSSELTDNKVEVTLTVSDPQGLSHSQTQHLTLSANQAPKAS
FTASCTHLVCQIDASASSDPDADTLSYQWQLGDGNSSDKLQLTHSYTQAGTYNIVLTVSD
GKTDNSSEKSVTVTVAPTPEPSENGSSGGAIGLFSLLLLALGIRRQTR
Download sequence
Identical sequences WP_049774353.1.77901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]